KEGG   Borrelia afzelii (FLI): BAPKO_0598Help
Entry
BAPKO_0598        CDS       T00383                                 

Gene name
cheB-2
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
baf  Borrelia afzelii (FLI)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:baf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAPKO_0598 (cheB-2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BAPKO_0598 (cheB-2)
Enzymes [BR:baf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BAPKO_0598 (cheB-2)
Two-component system [BR:baf02022]
 CheA family
  CheA-CheYBV
   BAPKO_0598 (cheB-2)
Bacterial motility proteins [BR:baf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BAPKO_0598 (cheB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
584285..585442
Genome map
AA seq 385 aa AA seqDB search
MKILVIDIQGLIKQVFVRAFSKDNDVEILNAGFNSLNLINVFLQKFPDLVIIDENTARSN
FGNSLNNVLNNISLPIVFIAQNEMFPNFGCLEQSKEKVKLIINKLNFKLTVDLFRSKYLA
LIKLELKNLGKNKLISSYEVKRIPSPDFSSHSKVELKKDSLDDSSIRKSYRVSDVINFAP
KNDPDVVIKYQGLLNKQRTGKIIVVGSSTGGTEALRIFLSSFKKDSPPIIIVQHMPGGFT
KSFAKNLNNEFNIDIKEAEDGDILRPGLVIIANGSYHLIVKYGSGNYFVNLLDGPLVSRH
KPSVNVLFRSAAMYAGANAIGVILTGMGDDGAICMLEMKKNGAYTIAQDQETSVVFGMPM
EAIKIGAVDKILPLSKIADHVLRRS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattagtaattgatattcaaggacttataaagcaggtttttgttagggctttt
tctaaagataatgatgttgaaatattaaatgctggctttaattctttgaatcttattaat
gtatttttacaaaagtttccagacttagttattattgatgagaatactgcaagatctaat
tttgggaattctttaaacaatgttcttaataatatatcccttccaattgtatttattgca
caaaatgaaatgtttccaaattttggatgtcttgagcaaagtaaagaaaaggttaaatta
ataataaataagcttaatttcaagcttacagttgatttatttcgcagtaagtatttagct
ttaataaagcttgagttgaaaaatctaggcaaaaataaattaatatcttcatatgaggtt
aaaagaattccttcacccgatttttctagtcattctaaggtagaattgaaaaaagatagt
ttagatgattcaagtataaggaaaagctatagagtttctgatgttattaattttgctccc
aaaaatgatccagatgttgttattaaatatcaaggtcttctcaataagcagagaacaggc
aaaattattgttgtgggctcttcaacaggtggcacagaagcgttaaggatttttttaagc
tcttttaaaaaggattcgcctccaattattattgttcaacatatgccgggaggatttaca
aaatcttttgcaaaaaacttaaataatgagtttaatattgatattaaagaagccgaagat
ggagacattcttcgtccaggtcttgtaataattgctaatggaagttatcatttgattgta
aaatatggtagtggaaattattttgtcaacttattagatggacctcttgttagtagacat
aagccttctgtaaatgtactttttaggtctgctgcaatgtatgcaggtgctaatgctatt
ggtgttatccttacaggtatgggagatgatggtgctatttgtatgcttgaaatgaaaaaa
aatggcgcttatactattgcccaagatcaagaaacatctgttgtttttggtatgccaatg
gaagctataaaaataggagctgtagacaaaatccttcctttaagcaaaatagctgatcat
gttctaaggagatcttag

DBGET integrated database retrieval system