KEGG   Borrelia afzelii (FLI): BAPKO_0702Help
Entry
BAPKO_0702        CDS       T00383                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
baf  Borrelia afzelii (FLI)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:baf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAPKO_0702 (gpmA)
   01230 Biosynthesis of amino acids
    BAPKO_0702 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPKO_0702 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BAPKO_0702 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAPKO_0702 (gpmA)
Enzymes [BR:baf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAPKO_0702 (gpmA)
Exosome [BR:baf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAPKO_0702 (gpmA)
  Exosomal proteins of melanoma cells
   BAPKO_0702 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701383..702129
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGVDEAIEAGLLLKQEGYFFDIAFSSLLSR
ANDTLNIILKELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVP
PMSLDESDDRHPIKDPRYKYIPKRELPSTECLKDTIARVIPYWIDEIAKEILEGKKVIVA
AHGNSLRALVKYLDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKHYYLGDENKIKKAMES
VASQGKLR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtaagacacggggagagtgagtggaacaaagaaaatcttttt
actggttggacagatgttaaactttctgataaaggtgtcgatgaggctatagaggcaggt
ttacttctcaagcaagaaggctatttttttgatattgcttttagttctttattgtcaagg
gccaatgatactttaaatattattttaaaagaactaggccaatcttatattagtgtaaaa
aaaacttggagattaaatgagagacactatggagctttgcagggtttaaataagtcggaa
acagctgcaaaatatggggaagataaggttttaatttggagacgcagttatgatgtgccc
ccaatgtctttagatgagtctgatgatcgtcatccaattaaggatccaagatataaatat
attcctaaaagagaacttccttcaacagagtgtcttaaagatactattgcaagagttatt
ccttattggattgatgagattgcaaaagaaattcttgaaggtaaaaaagttattgttgct
gctcatggtaattctttaagagctcttgttaaatatcttgataatttaagcgaagaagat
gttttaaagcttaacattcctacgggtattcctttagtttacgaattagataaagattta
aatcctattaaacattactatttaggtgatgaaaacaagattaaaaaggcaatggaatct
gttgctagtcaaggaaagttaaggtaa

DBGET integrated database retrieval system