KEGG   Borrelia afzelii (FLI): BAPKO_0771Help
Entry
BAPKO_0771        CDS       T00383                                 

Gene name
pfk
Definition
(GenBank) pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
baf  Borrelia afzelii (FLI)
Pathway
baf00010  Glycolysis / Gluconeogenesis
baf00030  Pentose phosphate pathway
baf00051  Fructose and mannose metabolism
baf00052  Galactose metabolism
baf00680  Methane metabolism
baf01100  Metabolic pathways
baf01110  Biosynthesis of secondary metabolites
baf01120  Microbial metabolism in diverse environments
baf01130  Biosynthesis of antibiotics
baf01200  Carbon metabolism
baf01230  Biosynthesis of amino acids
baf03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:baf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPKO_0771 (pfk)
   00030 Pentose phosphate pathway
    BAPKO_0771 (pfk)
   00051 Fructose and mannose metabolism
    BAPKO_0771 (pfk)
   00052 Galactose metabolism
    BAPKO_0771 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BAPKO_0771 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BAPKO_0771 (pfk)
Enzymes [BR:baf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BAPKO_0771 (pfk)
Protein phosphatases and associated proteins [BR:baf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BAPKO_0771 (pfk)
Messenger RNA biogenesis [BR:baf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BAPKO_0771 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABH01999
Position
769180..770523
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYASEGSSHFVNEKNKIKFSVYRNEDEGDKYED
VLLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVVDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFDHFPRKKDDSGNLLYEDIGLYIKDKITEYFKAKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMSGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaattaaaaatgaaaatttagattttaaaatagatagtttgggagaatgcaag
caaaacaatcctttgattgatttttatgctagcgaaggctcgtcgcattttgttaatgag
aaaaataaaattaagtttagtgtatatagaaatgaagatgagggagataagtatgaagat
gttcttttagaaaaagctggacctagagaaaaaatttattttgtgcccagacatgttaaa
gctgctattactacttgtggtggactttgtcctggttttaatgatgttattcgttctatt
gtgcgaactttatggaaaatttatggggttcgcaatatttatggggtaaaatttggatat
caaggtcttcttccggaatcaaattcaccttttattaatcttaatccagatgttgtggat
gatattaataaatttggaggtactattcttggctcttcaaggggtggtattaaacctgtg
gaaatagttgatactttagagagaatgaacattaatatgatttttaacattggcggagat
ggtactcaaaagggatctcttcttattgctgaggagatagaaaaaagaaatttgaaaata
gcagttgtaggcattcctaaaacggtagacaatgattttatgtttgttcaaaaatctttt
ggatttgagaccgctgtagaacaagcggttgcagctgttgctggcgctcattttgaagct
aatagtgcttataatgggattggacttgttaaggttatgggacgggattctggctttatt
gctgctcatactgcactttcttctaatgatgttaatttttgtttaattccagagcttgat
tttgacatagaaggtcctaatggatttcttgttcatcttgaaagacggcttttagagaaa
gaaagcttagaagaaattcctcatgcagtaatattgatagcagaaggagcaggtcaaaaa
tattttgatcattttcctcgcaagaaagacgattctgggaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaagcaaaaaatatccagtttacc
cttaaatacattgatcctagctatattattagaagttcacctgctaatgctagtgattcg
ctttattgtgctagacttgggtcaaatgctgtacacgccgcaatgtctggtaagacaaaa
atgttgattagcctgtggagtacaaaattcgtgcacataccaattaagatggcggtaatt
gatagaaataaggttaatccaaatggttctttttggagagatgttctttcaagcacaggg
caaccgattagtatgaagaattaa

DBGET integrated database retrieval system