KEGG   Borrelia afzelii HLJ01: BafHLJ01_0025Help
Entry
BafHLJ01_0025     CDS       T02298                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bafh  Borrelia afzelii HLJ01
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bafh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BafHLJ01_0025 (ruvA)
Enzymes [BR:bafh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BafHLJ01_0025 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22178..22768)
Genome map
AA seq 196 aa AA seqDB search
MINKIYGKVIEKKESSLVLMTAVFEFELLVSAFCLANFKLLDKVELFTYLYTKENELKLF
GFLNSDERETFKSLIRVSGIGPRAALRVLSNIRYNEFKDAIDREDIELIAKIKGIGKKMA
GKMFLHLQGKLLINNELESSLFRFKELEESIVSMGFDRKIVNSKLKEAFNLVEFSNLKDS
EKEQFLFKEVLKRMSN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgataaataagatttatggtaaagttatagaaaaaaaagaatctagtttggttttaatg
acggctgtttttgaatttgagcttttagttagtgcattttgccttgctaattttaagttg
ttagacaaagttgaactgtttacctatctttatacgaaagaaaatgaattaaaacttttt
ggatttttgaattcagatgaaagagagacttttaaaagtcttattagagtaagtggaata
ggcccaagggctgctttaagagtgctttctaatataaggtataatgagtttaaggacgct
attgatagagaagatattgagcttattgctaaaatcaaaggtattggcaaaaaaatggct
ggtaaaatgtttttacatcttcagggtaagcttttgattaataatgagcttgaatctagt
ctttttagatttaaagaattagaagaatcgattgttagtatgggatttgacagaaaaatt
gttaatagtaagcttaaggaggctttcaatctggttgaattttcaaatttaaaagactct
gaaaaggaacagtttttatttaaggaggttttaaaaagaatgtcaaattaa

DBGET integrated database retrieval system