KEGG   Borrelia afzelii HLJ01: BafHLJ01_0220Help
Entry
BafHLJ01_0220     CDS       T02298                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bafh  Borrelia afzelii HLJ01
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bafh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BafHLJ01_0220 (gtaB)
   00052 Galactose metabolism
    BafHLJ01_0220 (gtaB)
   00500 Starch and sucrose metabolism
    BafHLJ01_0220 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BafHLJ01_0220 (gtaB)
Enzymes [BR:bafh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BafHLJ01_0220 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
208343..209179
Genome map
AA seq 278 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPAIDYIIQEFIDSGIKDILLISSRRKKVL
EDYFDREIELENIFLKENKENELEKIKDKKINISFIRQKEMMGTGNALLYAKPWINREPV
IVAYPDDLHIGNPPLSLQLIKLHEKTGKSIISIIENPENINRYGVIELYKDEIHVKNIVE
KPKIGSEPSNKASIGRFLYNYEFFEHLEEGFKLHQKGEYYHIYALKKLMDQKKVLYRNIK
GKRIDIGTLEGYLEAIINFAKKDKNLMEIIKKGINEND
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtattattttggcagctgggtatggaacaagatttttaccaataacaaaaaca
attccaaaagaaatgttaccaattttaaacaaaccagccatagattatattatccaagaa
tttatcgattcaggaataaaagacattttattaataagctcaagacggaaaaaagttctt
gaagattattttgacagagaaattgaacttgaaaacattttcttaaaagaaaataaagaa
aatgaattagaaaagattaaagacaaaaaaattaacataagcttcataaggcaaaaagaa
atgatggggacgggaaatgcactactttatgcaaagccctggataaatagagaacctgta
attgtggcctaccctgacgatctgcatatcggaaatccaccattaagcttacaattgata
aaacttcatgaaaaaactggaaaaagtataatatctatcattgaaaatccagaaaatata
aacagatatggagtaatagaactctacaaagacgaaatccatgtaaaaaacattgttgaa
aaaccaaaaattggaagtgagcctagcaataaagcatctattggaagatttttgtacaac
tatgaattttttgaacatttagaagaaggatttaaactacatcaaaaaggtgaatattat
cacatttatgctttaaaaaagctgatggatcaaaaaaaagtattatatagaaatattaag
ggaaaaagaattgatataggaactcttgagggctatttagaggcaataataaattttgca
aaaaaagataaaaatttaatggaaattataaaaaaaggaataaatgaaaacgattaa

DBGET integrated database retrieval system