KEGG   Borrelia afzelii HLJ01: BafHLJ01_0261Help
Entry
BafHLJ01_0261     CDS       T02298                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bafh  Borrelia afzelii HLJ01
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bafh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BafHLJ01_0261 (glpK)
Enzymes [BR:bafh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BafHLJ01_0261 (glpK)
Exosome [BR:bafh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BafHLJ01_0261 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
245263..246768
Genome map
AA seq 501 aa AA seqDB search
MKYILSIDQGTTSSRAIVFDKNANIKGIAQKEFTQIYPQPSWVEHDPTEIWGSQLGVITE
ALANSRILPNEVDAIGITNQRETTVIWEKNTGKPIYNAIVWQDRRTAKICDQLTKEGKDK
IILEKTGLVLDSYFSGTKILWILDNVEGARQKAENGELCFGTIDTWLLWNLTQKKVHATD
YSNASRTLLLNIKTLEWDDELLNILNIPKAILPELKESSTMYGKTDKSLFGAEIPIAGIA
GDQFAATFGQACLKKGMAKNTYGTGCFLTVNIGKEPIINHERLLTSIAWGRKKSVTYVLE
GSVFIGGAVIQWLRDGLEFFRKSSDAESLASSASDNGGVYFVPAFVGLGAPHWDSYARGT
IIGITRGSTKAHITRAALESIAFQSFDILNTMKKSIPNFEIKELRVDGGASQNNLLMQFQ
ADLLECKVVRPKITETTALGAAYLAGLASGYWQSAEEIVSLWQVDKIFKPSMPKNQKEKL
LENWNRAIERSKSWIQNSHSL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattttatctattgatcaaggtactactagctcaagagcaatagtatttgac
aaaaatgcaaacataaaggggattgctcaaaaagaatttactcaaatttatccacaacca
agctgggtggaacacgatcctaccgaaatatggggatcacaacttggagttataacagaa
gctcttgcaaattcaagaattttaccaaatgaagttgatgctattggaataactaatcaa
agagaaactacagttatatgggaaaaaaatacaggaaaacccatttacaatgcaatagta
tggcaagacagaagaactgcaaaaatttgtgaccaattaacaaaagaaggaaaagataaa
attattttggaaaaaacaggcttagtgttagattcttattttagcggaacaaaaatactg
tggatcttggataatgtagagggcgccagacaaaaagctgaaaatggtgaattatgcttt
ggaacaatagatacatggctattatggaatctaactcaaaaaaaagtacatgcaactgat
tactccaatgcttcaagaacattattgttaaacattaaaacattagaatgggatgatgaa
cttttaaacatattaaatattccaaaagcaattttgcccgaacttaaagaaagttctaca
atgtatggtaaaacagataaatcgctatttggagcagaaattcctattgcaggaattgca
ggagatcaatttgcagcaacatttggacaagcttgccttaaaaaaggtatggctaaaaac
acatatggaactggttgctttttaacagtaaatataggaaaagaaccaattattaaccat
gaaaggcttttaacttcaattgcatggggaagaaaaaaatctgtaacttatgttcttgaa
ggaagtgtttttattggtggagccgtaatccaatggctaagagacggtcttgaatttttc
agaaaaagttcagatgcagaatcattagcaagctctgcttcagataatgggggagtttat
tttgtgccagcatttgttggccttggtgcacctcattgggattcttatgcaagaggaaca
atcatcggaataacaagaggatcaacaaaagctcacattacaagagctgctcttgagagc
atcgcatttcaaagttttgatatactaaataccatgaaaaaatccattcctaattttgaa
attaaagaattaagagtagacggaggagcaagtcaaaataatctattgatgcaatttcaa
gctgatcttttagaatgtaaagttgtaagaccaaaaataacagaaacaaccgctcttgga
gctgcttatcttgcagggcttgcatcaggttattggcaaagcgccgaagaaattgtaagt
ctttggcaagtagataaaatattcaaaccatcaatgccaaaaaatcaaaaagaaaaactt
cttgagaattggaacagagcaattgaaagatcaaaatcctggatacagaattctcatagt
ctataa

DBGET integrated database retrieval system