KEGG   Borrelia afzelii HLJ01: BafHLJ01_0622Help
Entry
BafHLJ01_0622     CDS       T02298                                 

Gene name
cheB-2
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bafh  Borrelia afzelii HLJ01
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bafh02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bafh02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
582381..583538
Genome map
AA seq 385 aa AA seqDB search
MKILVIDIQGLIKQVFVRAFSKDNDVEILNAGFNSLNLINVFLQKFPDLVIIDENTARSN
FGNSLNNVLNNISLPIVFIAQNEMFPNFGCLEQSKEKVKLIINKLNFKLTVDLFRSKYLS
LIKLELKNLGKNKLISSYEVKRIPSPDFSSHSKVELKKDSLDDSSIRKSYRVSDVINFAP
KNDPDVVIKYQGLLNKQRTGKIIVVGSSTGGTEALRIFLSSFKKDSPPIIIVQHMPGGFT
KSFAKNLNNEFNIDIKEAEDGDILRPGLVIIANGSYHLIVKYGSGNYFVNLLDGPLVSRH
KPSVNVLFRSAAMYAGANAIGVILTGMGDDGAICMLEMKKNGAYTIAQDQETSVVFGMPM
EAIKIGAVDKILPLSKIADHVLRRS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattagtaattgatattcaaggacttataaagcaggtttttgttagggctttt
tctaaagataatgatgttgaaatattaaatgctggctttaattctttgaatcttattaat
gtatttttacaaaagtttccagacttagttattattgatgagaatactgcaagatctaat
tttgggaattctttaaacaatgttcttaataatatatcccttccaattgtatttattgca
caaaatgaaatgtttccaaattttggatgtcttgagcaaagtaaagaaaaggttaaatta
ataataaataagcttaattttaagcttacagttgatttatttcgcagtaagtatttatct
ttaataaagcttgagttgaaaaatctaggcaaaaataaattaatatcttcatatgaggtt
aaaagaattccttcacccgatttttctagtcattctaaggtagaattgaaaaaagatagt
ttagatgattcaagtataaggaaaagctatagagtttctgatgttattaattttgctccc
aaaaatgatccagatgttgttattaaatatcaaggtcttctcaataagcagagaacaggc
aaaattattgttgtgggctcttcaacaggtggcacagaagcgttaaggatttttttaagc
tcttttaaaaaggattcgcctccaattattattgttcaacatatgccgggaggatttaca
aaatcttttgcaaaaaacttaaataatgagtttaatattgatattaaagaagccgaagat
ggagacattcttcgtccaggtcttgtaataattgctaatggaagttatcatttgattgta
aaatatggtagtggaaattattttgtcaacttattagatggacctcttgttagtagacat
aagccctctgtaaatgtgctttttaggtctgctgcaatgtatgcaggcgctaatgctatt
ggtgttattcttacaggtatgggagatgatggtgctatttgtatgcttgaaatgaaaaaa
aatggcgcttatactattgcccaagatcaagaaacatctgttgtttttggtatgccaatg
gaagctataaaaataggagctgtagacaaaatccttcctttaagcaaaatagctgatcat
gttctaaggagatcttag

DBGET integrated database retrieval system