KEGG   Borrelia afzelii HLJ01: BafHLJ01_0681Help
Entry
BafHLJ01_0681     CDS       T02298                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bafh  Borrelia afzelii HLJ01
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bafh00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bafh00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(648521..650185)
Genome map
AA seq 554 aa AA seqDB search
MKRNFYLILLFIANNCFSIDFWDTMEREKLINEMVSKMQDHELLGQMFMISYPNQSITNF
VLDFISQKNLGGIKIFGWNAKNLKNLTESINKAQKTSQNNKFKIPLFVATDQEGGLAHHI
KSNTSETIGNLGIAASLSSKDSYNTGYYIAQELSRLGINLNFAPIVDIYSDENNFTIGPR
TYSDNPKIVSLLSLAFYKGQKQGGIISTAKHFPGHGNTTLDSHINIPIINSNLLEINLNE
LLPYKILIQENIPVIMTGHLAYPKLTNGENIPASSSTKIIKNILRKKLKYNNIIITDDLL
MAAAKYNNESIYNTIKRIARTKSDIFLISLNENIQKNAYNMLLNLMKKDSEIKNNIIEAN
KRILRIKLIYLKENKNKSDLYPNFNKDEKIYSKEGEKFFEQNTLRGITKVRIEKEISKTK
KTLIISPYYKMITEGKKIFQNIYAYYYNYYLKWINLQKLDEIKKLIKNFEQVIFNLSTPG
SLKYLENLKEYKDKISVIASLTPQHIKKLNWIKNIVIIYGTTPLAFKSGFLTLTKDFDPK
GNIPLSNIINKYYP
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaatttttatcttattctcctttttatagctaacaactgcttctccattgat
ttttgggatacaatggaaagagaaaaattaataaatgaaatggtaagtaaaatgcaagat
catgagctactaggacaaatgtttatgataagctatccaaatcaatcaataacaaatttt
gttcttgattttataagtcaaaaaaaccttgggggaattaaaatttttggatggaacgca
aaaaatttaaaaaacttaacagaaagtattaataaagctcaaaaaacatctcaaaataat
aaatttaaaattcctttatttgtagcaacagatcaagaaggaggattggcacaccatata
aaatcaaatacatcagaaacaattggcaatcttggaattgcagcatctctgtcttcaaaa
gactcttataatacagggtattatatagcacaagagttaagtcggctaggaataaattta
aatttcgcacccatagtagatatatatagcgacgaaaataatttcacaataggtccaaga
acatattcagataaccctaaaatagtatcacttctttctctagccttttacaaagggcaa
aaacaaggaggaataatttctactgcaaagcatttcccaggacacggcaatactactctt
gactcccatataaatattccaataataaattctaatctactagaaataaacttaaatgaa
cttttgccatataaaatattaatccaagaaaatatcccggtaataatgacaggccaccta
gcatatccaaagcttacaaatggagaaaatattcccgcatcatcctcaacaaaaataatt
aaaaatatactaagaaagaaattaaaatacaataatataataattaccgatgatctattg
atggccgcagcaaaatacaataatgagagtatttacaatacaattaaaagaatagctaga
accaaaagtgacatttttttaatatctttaaatgaaaatatacaaaaaaatgcttacaac
atgctgctaaacttaatgaaaaaagattcagaaataaaaaataatattattgaagctaat
aaaagaatattaagaattaaattaatatacttaaaagaaaataaaaataaatctgatctt
tatcctaatttcaataaagatgagaaaatatattcaaaagaaggtgaaaaattttttgaa
caaaacacattaaggggtattacaaaagtaagaatagaaaaagaaatatctaaaactaaa
aaaacacttataatatctccttactataaaatgattacagaaggcaaaaaaatatttcaa
aatatatatgcttattattacaactattatcttaaatggattaatctccaaaaactcgac
gaaattaaaaaattaattaaaaattttgaacaagtcatctttaatttatcaacgcccgga
agcctaaaatatttagaaaatttaaaagaatataaagataaaataagtgtaattgcatct
cttacccctcaacatattaaaaaattaaattggataaaaaacatagtaattatttatgga
acaacgcctctagcatttaaatctggatttttaacactcactaaagattttgatccaaaa
ggaaatatccctttaagcaatattataaataaatattatccttaa

DBGET integrated database retrieval system