KEGG   Borrelia afzelii HLJ01: BafHLJ01_0698Help
Entry
BafHLJ01_0698     CDS       T02298                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bafh  Borrelia afzelii HLJ01
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bafh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BafHLJ01_0698 (recD)
Enzymes [BR:bafh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BafHLJ01_0698 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(665018..666850)
Genome map
AA seq 610 aa AA seqDB search
MRDFLVLREFLKDKNKKFLTPELKLYEIIELLNINKKNCYKAQTLAKSINNENIVIFLIF
LFNYFDKGHLRANINLLAKDIQNTITFTKDNLEKTNKGYNKLIKMLKSLEIFGNLETIKD
IVSLLKKSNILMEFNKFKITTPLILENNIYIYTQKNYREEEDLIKQIIKRLENNKSELND
TEIQNIISNLNTNNLNKDQITSVRKALKSNFFLLSGGPGTGKTTTINYILKAINKTLNNK
KKRIVAIGAPTGKASLRLQASIDYSFENLEIECNTIQKLLGIKFINKKNLYDEENQLNFD
VIIIDEASMVDAYTFLKLLKATPITTKLIMVGDKNQLPSVNEGNVYSSLLGIENINKDNV
VDLKENFRSNKEINLLSKAIYKEDITLICKYINNNKNIQLKEIEKINLKKDLIEYANNLY
GKISTFNLKLLKDSKIKTILETLLENIILSSKNFGKFGTKTLNEIIKTYLKKIYGNFIGQ
IIMITKTDYKNKLFNGERGVIFNENSKFYALFQRKDEKYKKINLDLLTNYEFSFATTIHK
SQGSEYKHIKVILENNPFLTKELMYTAITRAKDSLEIISNKETILKLSKKSCERDSKILE
HLNSFKEIDK
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttttagtattaagagaatttttaaaagataaaaacaaaaaattcttaact
cctgaacttaagctttatgaaataattgaacttttaaatatcaataaaaaaaattgctat
aaagcacaaacacttgcaaagtccataaacaatgaaaacattgtaatatttttaatattt
ttatttaactactttgacaaaggccacttaagagctaatataaatctattagcaaaagac
attcaaaatacaataacattcacaaaagataacctagaaaaaaccaataaaggttataac
aaattaataaaaatgctaaaaagtttagaaatatttgggaatctagaaactattaaagat
atagtctcgcttttgaaaaaaagcaacatactaatggaatttaataagtttaaaattaca
actcccctaatcctggaaaacaatatctacatttatactcaaaaaaactatagagaagaa
gaagatttaataaaacaaattataaaaagattagaaaacaataaaagtgaattaaatgac
accgaaatacaaaatataatatcaaatttgaacaccaataatttaaataaagatcaaatc
acatccgtgagaaaggcattaaaaagcaacttttttctattaagcgggggccctggaaca
ggcaaaactacaactattaactatatcttaaaggcaattaacaaaacattaaacaataaa
aaaaaaagaatagtagcaattggagcacctacaggaaaagccagcttaagactacaagca
agtatcgattattcattcgaaaatttagaaatagaatgcaatacaatccaaaaactattg
ggaatcaaatttataaacaaaaaaaatctatatgatgaagaaaatcaactaaattttgac
gtaataataattgacgaagcttcaatggtagatgcatatacttttttaaagctattaaaa
gcaacaccaataactactaaattaataatggtaggagataaaaatcaacttccatcggta
aatgaaggaaatgtatattcaagtcttctaggaatagaaaatataaacaaagataatgta
gtagatcttaaagaaaatttcaggagcaacaaagaaataaacttactctcaaaagccata
tacaaagaagatatcaccttaatttgcaaatacattaataacaataaaaatattcaatta
aaagaaatagaaaaaataaatttaaaaaaagatctaatagaatatgcaaacaacttatat
ggaaaaatatccacttttaatcttaaattactaaaagattcaaaaattaaaacaatactt
gaaactttacttgaaaatataattttaagttcaaaaaattttggaaaatttggaactaaa
acactaaatgaaataataaaaacttacctaaaaaagatctatggaaactttattgggcaa
ataataatgataactaaaactgactataaaaataaattatttaatggagaacggggtgtc
atttttaatgaaaattctaaattttatgctttattccaaagaaaagatgaaaaatataaa
aaaataaatctagatttactaacaaattatgaattcagctttgctacaacaatacacaaa
agccaaggatctgaatataaacatataaaagtaatattagaaaataacccttttttaaca
aaagaacttatgtatactgcaataacaagagctaaagatagcttagaaataatttctaat
aaagagactattcttaagctaagcaaaaaatcttgcgaaagagattcaaaaatactagaa
cacttaaactcatttaaagaaattgacaaataa

DBGET integrated database retrieval system