KEGG   Borrelia afzelii (Maryland): BafPKo_0023Help
Entry
BafPKo_0023       CDS       T02093                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bafz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BafPKo_0023 (ruvA)
Enzymes [BR:bafz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BafPKo_0023 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22193..22783)
Genome map
AA seq 196 aa AA seqDB search
MINKIYGKVIEKKESSLVLMTAVFEFELLVSAFCLANFKLLDKVELFTYLYTKENELKLF
GFLNSDERETFKSLIGVSGIGPRAALRVLSNIRYNEFKDAIDREDIELIAKIKGIGKKMA
GKMFLHLQGKLLINNELESSLFRFKELEESIVSMGFDRKIVNSKLKEAFNLVEFSNLKDS
EKEQFLFKEVLKRMSN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgataaataagatttatggtaaagttatagaaaaaaaagaatctagtttggttttaatg
acggctgtttttgaatttgagcttttagttagtgcattttgccttgctaattttaagttg
ttagacaaagttgaactgtttacctatctttatacgaaagaaaatgaattaaaacttttt
ggatttttgaattcagatgaaagagagacttttaaaagtcttattggagtaagtggaata
ggcccaagggctgctttaagagtgctttctaatataaggtataatgagtttaaggacgct
attgatagagaagatattgagcttattgctaaaatcaaaggtattggcaaaaaaatggct
ggtaaaatgtttttacatcttcagggtaagcttttgattaataatgagcttgaatctagt
ctttttagatttaaagaattagaagaatcgattgttagtatgggatttgacagaaaaatt
gttaatagtaagcttaaggaggctttcaatctggttgaattttcaaatttaaaagactct
gaaaaggaacagtttttatttaaggaggttttaaaaagaatgtcaaattaa

DBGET integrated database retrieval system