KEGG   Borrelia afzelii (Maryland): BafPKo_0054Help
Entry
BafPKo_0054       CDS       T02093                                 

Gene name
tpiA
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bafz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BafPKo_0054 (tpiA)
   01230 Biosynthesis of amino acids
    BafPKo_0054 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BafPKo_0054 (tpiA)
   00051 Fructose and mannose metabolism
    BafPKo_0054 (tpiA)
   00562 Inositol phosphate metabolism
    BafPKo_0054 (tpiA)
Enzymes [BR:bafz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BafPKo_0054 (tpiA)
Exosome [BR:bafz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BafPKo_0054 (tpiA)
  Exosomal proteins of bladder cancer cells
   BafPKo_0054 (tpiA)
  Exosomal proteins of melanoma cells
   BafPKo_0054 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(50465..51226)
Genome map
AA seq 253 aa AA seqDB search
MRKTFLAGNWKMHYTSAEASIVAKQIATEVKTLNDDFVIMITPPFTALSKVSECIKGSNI
LLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKIRAGLKH
SFKYLILCVGETLDERDSGKTLDVVLSQVKKGLDCVSESDIKRIILAYEPVWAIGTGKTA
TKEEAEEVHKAIRLEIMKLYSKSASDNIIIQYGGSVNASNIKELMNEPNIDGALIGGASL
KAESFLSIINNVR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaacttttttagcgggaaattggaaaatgcattatacaagtgcagaagcttct
attgttgcaaaacaaattgcaactgaagttaaaactttaaatgatgattttgtaataatg
ataactcctccatttacggctttgtctaaggtttcagaatgtattaagggtagtaatatt
cttcttggtgctcaaaacatgtcttatatggaaagtggagcaagaacaagcgagatttcg
ccttcaatgcttttagaatttggagtagaatatgttatacttggtcattctgaatgtaga
ttatatttagcagaaacagacgaaataataaataaaaagattcgtgcggggcttaagcat
tcttttaagtatttaattctttgtgttggagaaactcttgatgagagagattctggaaaa
actttagatgttgttttgagtcaggttaaaaaggggttagattgtgtttctgagtcagat
attaagagaataattttagcttatgaacctgtttgggcaattggaacgggtaaaactgca
actaaagaggaagcagaagaagttcataaggcaattagacttgagattatgaagctttat
tcaaaatcagcttcagataatattataattcagtatggaggctctgttaatgctagcaat
ataaaagagcttatgaatgagcccaatatcgatggtgctttaataggtggagcatctttg
aaggctgaatcttttttatctataatcaataacgttcgttag

DBGET integrated database retrieval system