KEGG   Borrelia afzelii (Maryland): BafPKo_0188Help
Entry
BafPKo_0188       CDS       T02093                                 

Definition
(GenBank) putative membrane protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEL69421
UniProt: Q0SNX2
Position
189755..190408
Genome map
AA seq 217 aa AA seqDB search
MNLFLLTSLPLMLKIYMNIQLKQNKAKNTQAHALAIFFAITFFSFLYLTQEFILYRPFEL
NYTSIIGLGISIFIKEHLYYYIFPLLIFIFFFTLNENSSFRVNLTILIYFAFGLIFSKNL
EIAILNSKVFGIYEYIELPILNAIELIFSAIIFEKKIKKCQKYSVKEYKIILSPILFLGL
FITTLKTLILTNMRIYTLTIFALVLILIAINNKYVRK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatttttattaacaagtctaccactaatgttaaaaatttatatgaatatccag
ttaaaacaaaataaagcaaaaaatacccaagcacatgctttagcaatattttttgcaata
acatttttttcttttctttatttaactcaagaatttattttatacagaccatttgaatta
aattatacatcaataataggcctaggaatttcaatatttatcaaagaacacttatactac
tatatattcccactattaatatttatatttttttttactctaaatgaaaattcttcattt
agagtaaatttaacaattcttatatatttcgcattcggactaatattttctaaaaaccta
gaaatagcaatcctaaatagcaaagtttttggaatctatgaatatattgaattaccaata
cttaatgcaatagagttaatattttcagcaataatctttgaaaagaaaattaaaaaatgc
caaaaatactcagtaaaagaatacaaaatcattctttctcctattctattcttaggatta
tttattacaaccttaaaaacattaattctaactaatatgcgcatctataccttaacaata
tttgcattagttttaatactcatagcaattaataataagtatgttagaaaataa

DBGET integrated database retrieval system