KEGG   Borrelia afzelii (Maryland): BafPKo_0192Help
Entry
BafPKo_0192       CDS       T02093                                 

Gene name
prfA
Definition
(GenBank) peptide chain release factor 1
  KO
K02835  peptide chain release factor 1
Organism
bafz  Borrelia afzelii (Maryland)
Brite
Translation factors [BR:bafz03012]
 Eukaryotic Type
  Release factors
   BafPKo_0192 (prfA)
 Prokaryotic Type
   BafPKo_0192 (prfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCRF RF-1 MIR UCH
Motif
Other DBs
NCBI-ProteinID: AEL69425
UniProt: Q0SNW8
Position
193489..194562
Genome map
AA seq 357 aa AA seqDB search
MFLEKLNSATSRIKSIEEKLQDINLIKNQKKYSKIIKEYTYLEKINTKKIEYENILNQIN
DNKTILEKEEQQEMKELIKQELIDLDKKKENLEHEIKILLLPQDENDSKNIIIEIRAGTG
GEEAALFANNLYSMYIKYSEKKKWKTEIINFNETELGGFKEIIFEIKGKDVFKKLKYESG
VHRVQRIPITESNGRLQTSAATVAVLPNIEETEIDINEKDLRIDVYRSSGAGGQHVNTTD
SAVRITHLPTGIVVQCQNERSQHKNKDQAMKILRARLYEFEDSKKQEQRSNNRKQQVGSG
DRSERIRTYNFPQNRITDHRANITLYKLEEFMQGELDQLLDPLTIELQEQTLKSNNI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaaaaattaaattcagcaacaagcagaattaagtcgatagaagaaaaattg
caagacataaatctaattaaaaatcaaaaaaaatattcaaaaataataaaagaatataca
tacttagaaaaaataaatactaaaaagattgaatacgaaaacatactaaatcaaattaat
gataacaaaaccatcttggaaaaagaagagcaacaagaaatgaaagagctaataaagcaa
gaactaattgatctagataaaaaaaaggaaaatcttgaacatgaaataaaaatattactt
ttacctcaagatgaaaatgatagtaaaaatataataattgaaattagagctggaacaggt
ggagaagaagctgctctttttgcaaataatctttatagcatgtatataaaatattcagag
aaaaaaaaatggaaaacagaaatcataaacttcaatgaaacagaacttgggggatttaaa
gaaataatctttgaaattaaaggaaaagatgtatttaaaaaattaaaatacgaaagtggt
gttcacagagtgcaaagaattcctataacagagtctaacggaagacttcaaacctcagct
gctactgtagcagtactacctaatattgaagaaactgaaattgatattaatgaaaaagat
ttaagaattgatgtttacagatcatctggggctggtggacaacacgttaatacaactgat
tctgcagtaagaataacacacctgccaacaggaattgttgtacagtgtcaaaatgaaaga
agtcaacataaaaacaaagatcaagcaatgaaaatattaagagcaagactttatgaattt
gaagattccaaaaaacaagaacaaagatcaaacaatagaaaacaacaagtcggctcagga
gatagatctgaaagaattagaacctataattttcctcaaaatagaataacagatcacaga
gcaaacatcactctttataaattagaagaatttatgcaaggagaacttgatcaacttctt
gaccccttgacaatagaacttcaagaacaaacattaaaaagcaacaatatatag

DBGET integrated database retrieval system