KEGG   Borrelia afzelii (Maryland): BafPKo_0199Help
Entry
BafPKo_0199       CDS       T02093                                 

Definition
(GenBank) CBS domain pair family protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF21 CBS CorC_HlyC
Motif
Other DBs
NCBI-ProteinID: AEL69431
UniProt: G0IR45
Position
202526..203749
Genome map
AA seq 407 aa AA seqDB search
MILLFIILSAIFSASETAYTSLSMIQIQDIRKKGKSGISVYNLVQSPSKLITTILIGNNI
SNIVASTLTTKFVLEKYGNNALAISTGLITIIVLIFAEILPKQIAILNNEIIALSTSFFL
KPLIFIFTPLIYIINKIIKKILTIFKIKTSHKMTKESIKNMLSLAGNLGILKNDSRIFMQ
KMLDIDQVRASEIMTHRTEVFSLSSSSKLKDVIKLIKEEGYSRIPIYKRQSREQIIGILI
AKDLIEINKKDMNKNISQFIKPAVFVQQNKRIKDILDIMRKKQKIMAIVIDEYGGFSGIL
TIEDIVEKIFGAISDEYDIKEEKPLITQINDNTYSILGETTFDEIEEIVGISIKHKEYTN
TIGGYLIDLLDKIPKKDETVKTTDGEYFIKEIQNNKIETITFIKAKK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
ttgatattactatttataatattatctgctattttctcggcatctgagacagcttacact
tctttaagcatgattcagatacaagatataagaaaaaaaggaaaatcaggaatatcggtg
tataacttggttcaatctccttcaaaattaatcactactattcttatcggcaacaatata
tcaaatattgtagcaagtacacttacaacaaaatttgtacttgaaaaatatggaaataac
gctcttgcaatatcaacaggcctaataacaataatagttctaatttttgcagaaatactt
ccaaaacaaattgcaattctaaataatgaaatcattgctttatctacttcatttttttta
aagccattaatttttatatttactccactaatatacataataaacaagataataaaaaaa
atattaacaatctttaaaattaaaacaagtcataaaatgactaaagaaagcataaaaaat
atgctttctttagcaggaaatttaggaattttaaaaaacgactctagaatatttatgcaa
aaaatgttagacatagatcaagtaagagcttctgagattatgactcacagaacagaggtt
ttttcactctcaagctcatcaaagctaaaagatgtaatcaaattgatcaaagaagaagga
tactctagaattcctatatacaaaaggcaaagcagggaacagataattggaattttaata
gctaaagaccttatagagataaataaaaaggatatgaataaaaacatttctcaatttatt
aaaccggctgtatttgtacaacaaaacaaaagaataaaagacatattagatattatgagg
aaaaagcaaaaaataatggcaatcgtaattgacgagtatggtggtttttcaggaatactt
acaatagaagacatagtagaaaaaatttttggagcaatatctgacgagtacgacattaaa
gaggaaaagcctctgattacacaaatcaacgacaatacttactcaatacttggagaaact
acttttgacgagattgaagagatagttggaatatctatcaaacataaagagtatacaaat
acaattggaggatacttaatagatttacttgataaaatacccaaaaaagacgaaaccgta
aaaacaactgatggagaatattttattaaggaaattcagaataataaaatcgaaacaata
acttttatcaaggctaaaaagtaa

DBGET integrated database retrieval system