KEGG   Borrelia afzelii (Maryland): BafPKo_0205Help
Entry
BafPKo_0205       CDS       T02093                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cons_hypoth95 MethyltransfD12 MTS TRM
Motif
Other DBs
NCBI-ProteinID: AEL69435
UniProt: G0IR49
Position
complement(207724..208188)
Genome map
AA seq 154 aa AA seqDB search
MSLVREAFFSIIFKDIINSKFLDVFAGTGIMSIEALSRGASLAHLVECNKKTKSTLVKNF
SFVEEFYKFFFQRAEDFLSKKDLFYDFIYLDPPFNYKDKINLLEIILKGKILNDKVNIIM
HCPFGEDLDINTSKFSVYNLKRYGGSKLIFLKIL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgtcagagaagcctttttttctattatttttaaagatattattaactcaaaa
tttttggatgtttttgcggggactggaataatgtctattgaggctcttagcaggggagca
agtcttgcccatcttgttgaatgtaataaaaaaaccaaaagtacattagtgaaaaatttt
agctttgttgaggaattttataagtttttttttcaaagagcagaggattttttgagtaaa
aaagatcttttttatgattttatttatcttgatcctccttttaattataaagataagatt
aatttgcttgagattattttaaaaggtaaaattttaaatgataaagttaatatcattatg
cattgtcctttcggtgaagatttagacataaatacatcaaaattttcagtttataatttg
aaaaggtatgggggatcaaaacttatttttttgaaaatattgtag

DBGET integrated database retrieval system