KEGG   Borrelia afzelii (Maryland): BafPKo_0221Help
Entry
BafPKo_0221       CDS       T02093                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:3.6.3.27]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bafz00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BafPKo_0221 (pstB)
Enzymes [BR:bafz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.27  phosphate-transporting ATPase
     BafPKo_0221 (pstB)
Transporters [BR:bafz02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    BafPKo_0221 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_22 AAA_15 AAA_29 G-alpha AAA_18 Rad17 RNA_helicase AAA_16 AAA_23 PRK AAA_33 Adeno_IVa2 AAA_24 ATPase_2 AAA AAA_5 NACHT AAA_25 AAA_28 AAA_30
Motif
Other DBs
NCBI-ProteinID: AEL69448
UniProt: Q0SNU4
Position
222508..223290
Genome map
AA seq 260 aa AA seqDB search
MVKEKDKPKNEIIIETENLNLFYTDFKALNEINIKILKNSITALIGPSGCGKSTFLRTLN
RMNDLVEGIKIEGNVIYEGKNIYSNNFDILELRRKIGMVFQTPNPFLMSIYDNISYGPKI
HGTKDKKKLDEIVEQSLKKSALWDEVKDKLNTNALSLSGGQQQRLCIARTLAIEPNVILM
DEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFFLNGCIEEESPTD
ELFFNPKNTKTEEYISGKFG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaaagaaaaagataaaccaaaaaatgaaattataatagaaacagaaaatctaaat
ctattttatacagactttaaggctttaaacgaaataaatattaaaatactaaaaaatagt
attaccgctttaataggcccatctggctgcggcaaatcaacattcttaagaactctcaac
agaatgaatgaccttgttgagggtattaaaatagaaggcaatgtaatatatgaggggaaa
aacatttattcaaataatttcgatatcctagaacttagaagaaaaataggaatggtattc
caaactcctaatccatttttaatgtctatctatgacaatataagctatggaccaaaaatt
catggaacaaaagataaaaaaaaattagatgaaatagtagaacaatcactaaaaaaatct
gcactctgggacgaggtcaaagataaacttaatacaaatgctttaagcctgtcagggggt
caacaacaaagactctgcattgcaagaactcttgcaatagagccaaatgtaatactaatg
gacgaacctacctctgcacttgatccaatatcaacaggtaaaattgaagagctaataata
aacttaaaagaaagttacacaataatcattgtaactcataacatgcaacaggccggaaga
atatctgatagaaccgcatttttccttaacggctgcattgaagaagaaagtcctactgat
gaactattcttcaatcctaaaaatactaaaactgaagaatatattagcggaaaatttgga
taa

DBGET integrated database retrieval system