KEGG   Borrelia afzelii (Maryland): BafPKo_0236Help
Entry
BafPKo_0236       CDS       T02093                                 

Definition
(GenBank) orfR domain protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEL69463
UniProt: Q0SNS7
Position
complement(237445..238272)
Genome map
AA seq 275 aa AA seqDB search
MINLFFNNIKLFSLFVFNITICLFYLFLYDTSFFYFVLAILLINFFVILFYLRYFCSISF
KGSEIYYKGIFLSYNFDFNDIVSLEKRLSDNVLILKLKNKKRIKVCFWIDNGSSELFKEL
KIKRKDLFILKLENFPIRYYLSFAYLCMFLARIMISLFVYYISLSNIFIFLFICFIDIKV
LLGDFSVISKIVLFYEFRKDSIYERKIFKSEIYFYEFFEKIFIAREFEFNNKNYLCFSYK
GNHPTKKVYILNKKISYSMQKVFEYINQNYYTKLT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatttatttttcaataatataaaattatttagtttgtttgtttttaatattacg
atttgtttgttttatttgtttttgtatgacacaagttttttttactttgttttagcgatt
cttttgataaatttttttgtaattcttttttatttaagatatttttgctctatttctttt
aaggggtctgagatttattataaaggcatttttttaagttataattttgattttaatgac
attgtttcgcttgaaaaaagattgtcagacaatgttttgattttgaaattaaaaaataaa
aaaaggattaaggtttgtttttggatagacaatggttcgagtgaattattcaaagagctt
aagattaaaagaaaagatttatttatcctaaaattggaaaatttcccgataagatattat
ttgtcttttgcttatctttgcatgtttttagctcgcattatgattagtttatttgtttat
tatatttcattaagtaatatatttatttttttatttatttgttttattgacattaaagtt
ttgttaggtgatttttcagttattagtaagatagttttgttttatgaatttaggaaagat
tcaatttatgaaaggaaaatttttaaaagtgaaatttatttttatgaattttttgaaaaa
atttttattgctagggaatttgaatttaacaataaaaattatttatgtttttcttataaa
ggaaatcatccaacaaaaaaagtatatattttaaataaaaaaatttcttattctatgcaa
aaggtttttgaatatattaatcaaaactattatactaaattaacttaa

DBGET integrated database retrieval system