KEGG   Borrelia afzelii (Maryland): BafPKo_0245Help
Entry
BafPKo_0245       CDS       T02093                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09770  uncharacterized protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF327
Motif
Other DBs
NCBI-ProteinID: AEL69472
UniProt: Q0SNR7
Position
complement(249334..249828)
Genome map
AA seq 164 aa AA seqDB search
MKVNNLIAGALNLNSKDYKKGGKKVFFDKSNVFSSVFQTESVKEDKRFILLENGEFNLDL
IKNMLDGINEIGERLLSEPSRQNVIFYKKVISEFISIIISSSVCLKEQKGGSLGDPKRPK
YRIIKIINDKLDKLAYSVLQNQMSQIKLLDSIEEIQGLLVNLLM
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaataatttgattgctggggcattaaatcttaattcaaaagattataaaaaa
ggtggtaaaaaagtattttttgataagagtaatgttttttcttcagtgtttcagactgaa
agtgttaaagaagataagcgttttattttgcttgaaaatggcgaatttaatcttgatttg
attaaaaatatgttagatggaattaacgagattggcgagagacttttgagcgagccttca
aggcaaaatgttattttttacaaaaaagttatttcagagtttatatctattataatatca
tcttctgtttgtttgaaagagcaaaaaggggggagtttgggagatcccaagcgtcccaaa
tatagaattattaagattattaacgataagctagacaaacttgcctattctgttttgcaa
aatcaaatgagccagattaaacttttagatagcattgaagaaattcaaggtttacttgtg
aatttactaatgtaa

DBGET integrated database retrieval system