KEGG   Borrelia afzelii (Maryland): BafPKo_0257Help
Entry
BafPKo_0257       CDS       T02093                                 

Definition
(GenBank) peptidase M23 family protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AEL69483
UniProt: Q0SNQ6
Position
265250..266194
Genome map
AA seq 314 aa AA seqDB search
MYKIQKTLLILCILGIENINSEIINTIPKVLYKKEAFQGDYIYFASNKNFKRLSLLSINK
NPIISSSPFKFTVGSKTYYIAFIGITPMIKEGKRKIQIEYKNKSYIKEIEIKKFNFKKTK
ISFNKEKAKLITQKKSIKQKEQALVLWNIIGNIGDTTIYHYDTLVKPIKDQYIITSQYGD
LRLYMQGSKKISNYTMHNGIDYAPFKREKTPIFAAGKGKVVFAQNRELTGNTLIIQHLPG
IFTIYLHLSKLGTSENKVVNAGEYIGHTGNTGLSTGPHLHFEARINGIAINPDFLLNGML
IDKNKIINNIKRIE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatacaaaaaaccctacttatattgtgtattctaggaatagaaaatataaat
tcagaaataataaatactattcctaaagtcctttataaaaaagaggcatttcaaggggat
tacatatactttgcaagtaataaaaactttaaaaggttatcgcttttaagcataaataaa
aatccaatcataagttcttctcctttcaaatttacagtgggaagtaaaacttactacata
gcatttataggaattaccccaatgataaaagagggaaaaagaaaaattcaaatagaatac
aaaaataaaagttatatcaaagaaatagaaataaaaaaatttaacttcaaaaaaacaaaa
attagttttaataaagaaaaagccaaacttattacccaaaaaaaatctataaaacaaaaa
gaacaggctttggttttatggaacattattggcaatattggagacacaacaatataccac
tacgatactttagttaaaccgataaaagatcaatacattataacaagccaatacggagat
ttaaggctttacatgcaaggtagcaaaaaaatttcaaattatacaatgcacaatggaatt
gattatgctccatttaaaagagaaaagactccaatttttgctgctggcaaaggaaaagtt
gtatttgcacaaaatagagagctaacaggcaatacccttataatacaacatttgccaggc
atatttacaatttaccttcacctctcaaaattaggaacaagtgaaaataaagtagttaat
gctggcgaatatattggacacaccggaaatacaggcctctcaacaggcccccatttacac
ttcgaagcaagaattaatggtatagcaataaacccagatttccttttaaatggcatgctt
attgacaaaaataaaataataaataatattaaaagaatagagtaa

DBGET integrated database retrieval system