KEGG   Borrelia afzelii (Maryland): BafPKo_0318Help
Entry
BafPKo_0318       CDS       T02093                                 

Definition
(GenBank) branched-chain amino acid transport system / permease component family protein
  KO
K02057  simple sugar transport system permease protein
Organism
bafz  Borrelia afzelii (Maryland)
Module
bafz_M00221  Putative simple sugar transport system
Brite
Transporters [BR:bafz02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    BafPKo_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: AEL69544
UniProt: Q0SNJ4
Position
complement(322002..322934)
Genome map
AA seq 310 aa AA seqDB search
MTLFRNSFMALIFSFLILSISYFFGDFFQFSYIKMISWRFILFLIMATGIATCAKSNSLN
LGNEGQVYFGAFFVYIFSSFFGLTYFNFIYLIFLSSFFVGLLGLIPFFITFFFGLNRALT
GLLISYGNQRLVDGFILSMLKTGSFSNQTKRINSLFALDSSLIYLFLLGMSIWLFYVFMH
KKTIYGLQLEILSNKKKIDIFFNINEFKYKFFAVFGSAFLNGLAGSMFVVFFKPYLVLGL
TSGLGWNSLIVAVISGFNYIYVLFFSLLFSILIEFNNFLNINYDFKYEFIGLCQSIAIFL
SLFLIKVRKK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccttatttagaaatagctttatggcattaattttttcttttttgatattaagtatt
agctatttttttggtgatttttttcaattttcttatatcaagatgatatcttggcgcttt
attttatttttaattatggctactggtattgccacctgtgccaagagtaattcattaaat
cttggaaatgaggggcaagtttattttggagcatttttcgtttatatattttcaagtttt
tttggattaacctattttaattttatatatttgatatttttgagttctttttttgtagga
cttttggggcttattcccttttttattacctttttctttggattaaatagagctttaaca
ggtcttttaatatcttatggaaatcaaaggttggtagatggatttattttaagtatgtta
aaaacaggtagtttttctaatcagacaaagagaattaatagcttatttgccctagattca
tcacttatttacttgtttttgcttggtatgtcaatttggcttttttatgtttttatgcat
aaaaaaactatttatggacttcagcttgaaatattaagcaataagaaaaagatagatatt
tttttcaatataaatgaatttaaatataagtttttcgctgtatttggcagtgctttttta
aatggccttgcaggttctatgtttgtagtgttttttaagccctatttggttttaggacta
acctcaggacttggttggaatagcttaattgttgctgtaatttcaggatttaattatatt
tatgtgttattttttagcctattgttttcaatattaatagaatttaataattttcttaat
ataaattatgacttcaagtatgaatttattgggctttgtcaatcaattgctatttttctc
tctttatttttgattaaagttaggaaaaagtag

DBGET integrated database retrieval system