KEGG   Borrelia afzelii (Maryland): BafPKo_0321Help
Entry
BafPKo_0321       CDS       T02093                                 

Definition
(GenBank) hypothetical protein
Organism
bafz  Borrelia afzelii (Maryland)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEL69547
UniProt: G0IRN7
Position
complement(325497..325610)
Genome map
AA seq 37 aa AA seqDB search
MPKSYNKEKNVFFRCLDNFSISFGSGIFIACYQSFFI
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
ttgccaaaatcttataataaggaaaaaaatgtgttctttagatgtttagataatttttca
attagttttggcagtggtatttttatagcttgttatcaatctttttttatttga

DBGET integrated database retrieval system