KEGG   Borrelia afzelii (Maryland): BafPKo_0583Help
Entry
BafPKo_0583       CDS       T02093                                 

Definition
cheB methylesterase family protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bafz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BafPKo_0583
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BafPKo_0583
Enzymes [BR:bafz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BafPKo_0583
Two-component system [BR:bafz02022]
 CheA family
  CheA-CheYBV
   BafPKo_0583
Bacterial motility proteins [BR:bafz02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BafPKo_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
582844..584001
Genome map
AA seq 385 aa AA seqDB search
MKILVIDIQGLIKQVFVRAFSKDNDVEILNAGFNSLNLINVFLQKFPDLVIIDENTARSN
FGNSLNNVLNNISLPIVFIAQNEMFPNFGCLEQSKEKVKLIINKLNFKLTVDLFRSKYLA
LIKLELKNLGKNKLISSYEVKRIPSPDFSSHSKVELKKDSLDDSSIRKSYRVSDVINFAP
KNDPDVVIKYQGLLNKQRTGKIIVVGSSTGGTEALRIFLSSFKKDSPPIIIVQHMPGGFT
KSFAKNLNNEFNIDIKEAEDGDILRPGLVIIANGSYHLIVKYGSGNYFVNLLDGPLVSRH
KPSVNVLFRSAAMYAGANAIGVILTGMGDDGAICMLEMKKNGAYTIAQDQETSVVFGMPM
EAIKIGAVDKILPLSKIADHVLRRS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattagtaattgatattcaaggacttataaagcaggtttttgttagggctttt
tctaaagataatgatgttgaaatattaaatgctggctttaattctttgaatcttattaat
gtatttttacaaaagtttccagacttagttattattgatgagaatactgcaagatctaat
tttgggaattctttaaacaatgttcttaataatatatcccttccaattgtatttattgca
caaaatgaaatgtttccaaattttggatgtcttgagcaaagtaaagaaaaggttaaatta
ataataaataagcttaatttcaagcttacagttgatttatttcgcagtaagtatttagct
ttaataaagcttgagttgaaaaatctaggcaaaaataaattaatatcttcatatgaggtt
aaaagaattccttcacccgatttttctagtcattctaaggtagaattgaaaaaagatagt
ttagatgattcaagtataaggaaaagctatagagtttctgatgttattaattttgctccc
aaaaatgatccagatgttgttattaaatatcaaggtcttctcaataagcagagaacaggc
aaaattattgttgtgggctcttcaacaggtggcacagaagcgttaaggatttttttaagc
tcttttaaaaaggattcgcctccaattattattgttcaacatatgccgggaggatttaca
aaatcttttgcaaaaaacttaaataatgagtttaatattgatattaaagaagccgaagat
ggagacattcttcgtccaggtcttgtaataattgctaatggaagttatcatttgattgta
aaatatggtagtggaaattattttgtcaacttattagatggacctcttgttagtagacat
aagccttctgtaaatgtactttttaggtctgctgcaatgtatgcaggtgctaatgctatt
ggtgttatccttacaggtatgggagatgatggtgctatttgtatgcttgaaatgaaaaaa
aatggcgcttatactattgcccaagatcaagaaacatctgttgtttttggtatgccaatg
gaagctataaaaataggagctgtagacaaaatccttcctttaagcaaaatagctgatcat
gttctaaggagatcttag

DBGET integrated database retrieval system