KEGG   Borrelia afzelii (Maryland): BafPKo_0656Help
Entry
BafPKo_0656       CDS       T02093                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bafz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(665480..667312)
Genome map
AA seq 610 aa AA seqDB search
MRDFLVLREFLKDKNKKFLTPELKLYEIIELLNINKKNYYKAQTLAKSINNENIVIFLIF
LFNYFDKGHLRANINLLAKDIQNTITFTKDNLEKTNKDYNKLIKMLKSLEIFGNLETIKD
IVSLLKKSNILMEFNKFKITTPLILENNIYIYTQKNYREEEDLIKQIIKRLENNKSELND
TEIQNIISNLNTNNLNKDQITSVRKALKSNFFLLSGGPGTGKTTTINYILKAINKTLNNK
KKRIVAIGAPTGKASLRLQASIDYSFENLEIECNTIQKLLGIKFINKKNLYDEENQLNFD
VIIIDEASMVDAYTFLKLLKATPITTKLIMVGDKNQLPSVNEGNVYSSLLGIENINKDNV
VDLKENFRSNKEINLLSKAIYKEDITLICKYINNNKNIQLKEIEKINLKKDLIEYANNLY
GKISTFNLKLLKDSKIETILETLLENIILSSKNFGKFGTKKLNEIIKTYLKKIYGNFIGQ
IIMITKTDYKNKLFNGERGVIFNENSKFYALFQRKDEKYKKINLDLLTNYEFSFATTIHK
SQGSEYKHIKVILENNPFLTKELMYTAITRAKDSLEIISNKETILKLSKKSCERDSKILE
HLNSFKEIDK
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttttagtattaagagaatttttaaaagataaaaacaaaaaattcttaact
cctgaacttaagctttatgaaataattgaacttttaaatatcaataaaaaaaattactat
aaagcacaaacacttgcaaagtccataaacaatgaaaacattgtaatatttttaatattt
ttatttaactactttgacaaaggccacttaagagctaatataaatctattagcaaaagac
attcaaaatacaataacattcacaaaagataacctagaaaaaaccaataaagattataac
aaattaataaaaatgctaaaaagtttagaaatatttgggaatctagaaactattaaagat
atagtctcgcttttgaaaaaaagcaacatactaatggaatttaataagtttaaaattaca
actcccctaatcctggaaaacaatatctacatttatactcaaaaaaactatagagaagaa
gaagatttaataaaacaaattataaaaagattagaaaacaataaaagtgaattaaatgac
accgaaatacaaaatataatatcaaatttgaacaccaataatttaaataaagatcaaatc
acatccgtgagaaaggcattaaaaagcaacttttttctattaagcgggggccctggaaca
ggcaaaactacaactattaactatatcttaaaggcaattaacaaaacattaaacaataaa
aaaaaaagaatagtagcaattggagcacctacaggaaaagccagcttaagactacaagca
agtatcgattattcattcgaaaatttagaaatagaatgcaatacaatccaaaaactattg
ggaatcaaatttataaacaaaaaaaatctatatgatgaagaaaatcaactaaattttgac
gtaataataattgacgaagcttcaatggtagatgcatatacttttttaaagctattaaaa
gcaacaccaataactactaaattaataatggtaggagataaaaatcaacttccatcggta
aatgaaggaaatgtatattcaagtcttctaggaatagaaaatataaacaaagataatgta
gtagatcttaaagaaaatttcaggagcaacaaagaaataaacttgctctcaaaagccata
tacaaagaagatatcaccttaatttgcaaatacattaataacaataaaaatattcaatta
aaagaaatagaaaaaataaatttaaaaaaagatctaatagaatatgcaaacaacttatat
ggaaaaatatccacttttaatcttaaattactaaaagattcaaaaattgaaacaatactt
gaaactttacttgaaaatataattttaagttcaaaaaattttggaaaatttggaactaaa
aaactaaatgaaataataaaaacttacctaaaaaagatctatggaaactttattgggcaa
ataataatgataactaaaactgactataaaaataaattatttaatggagaacggggtgtc
atttttaatgaaaattctaaattttatgctttattccaaagaaaagatgaaaaatataaa
aaaataaatctagatttactaacaaattatgaattcagctttgctacaacaatacacaaa
agccaaggatctgaatataaacatataaaagtaatattagaaaataacccttttttaaca
aaagaacttatgtatactgcaataacaagagctaaagatagcttagaaataatttctaat
aaagagactattcttaagctaagcaaaaaatcttgcgaaagagattcaaaaatactagaa
cacttaaactcatttaaagaaattgacaaataa

DBGET integrated database retrieval system