KEGG   Bacillus coagulans 36D1: Bcoa_0022Help
Entry
Bcoa_0022         CDS       T01628                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bag  Bacillus coagulans 36D1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcoa_0022
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Bcoa_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(24749..25894)
Genome map
AA seq 381 aa AA seqDB search
MKQISLLGATGSIGTQTLDVIRNHPEAFRLAAFSAGRNLNLTRKIISEFHPALVSVADKE
DCARLKTEFGDSPVVLYGEKGMVETAVYAESDILVNAVLGSVGLLPTLEAIRAGKTVAIA
NKETLVTAGHLVMDAARRAETEILPIDSEHSAIFQCLQGENRDEIERLIITASGGSFRDY
TREQLETVTVKDALNHPNWSMGAKITVDSATMMNKGLEVIEAHWLFGLPFEKIDTILHRE
SIIHSLVEFRDSSVKAQLGMPDMRIPIQYALGFPKRLPLPDAKRLDLAEIGRLHFEKMDE
ERFYCLKLAYEAGKAGGSMPAVLNAANEVAVHAFLQEKISFLQIDQLIEKALARHNVIIH
PDLETIWAVDRETRDYVASLI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcaaatcagcttattgggggcgacgggctccattggtacacaaacgctggatgtg
atccggaaccatccggaagcattccggctcgcggccttttcagcagggagaaatctcaat
ttaacgaggaaaattatttcggagtttcatccggcgcttgtctctgtcgctgacaaagaa
gactgtgcccggctgaaaaccgaattcggggacagcccggttgtgctctacggggaaaaa
gggatggtcgaaacggcggtatatgccgaatcggatattttggtcaatgcggtgcttggc
agtgtcgggctgttgccgactttggaggcgatccgggcggggaaaactgttgcgatcgcc
aataaagaaacgctcgtcacagctggccacctcgtgatggatgcagcaaggcgcgccgaa
actgaaattcttccgatcgacagcgagcattccgccatttttcaatgtttgcaaggggaa
aaccgggatgagatcgaacggctcatcattaccgcatccggcggcagtttccgtgattat
acaagggaacagcttgaaaccgtcaccgtaaaagatgcgctgaaccacccgaattggtcg
atgggcgccaaaatcacggttgattcggcaacaatgatgaataaagggctcgaagtcatt
gaagcacactggctgttcggccttccctttgaaaaaattgatactatcctgcaccgcgaa
agcatcatccactctctcgtcgaattccgtgacagcagcgtaaaggcgcagctcgggatg
cccgatatgcgcatcccgattcaatatgcgctcggatttccaaaaaggttgccgctaccg
gatgcaaagcggctcgatttggcggaaatcggccggcttcattttgaaaaaatggatgaa
gaacgcttttactgcctgaaacttgcctatgaagccggaaaagccggcggatcgatgccg
gccgtgctgaatgcggccaatgaggtggcggtccatgcctttttgcaggaaaaaatttcg
tttttgcaaattgatcagttgattgaaaaggcgcttgcaaggcataatgtaattatacac
cctgatttggaaacgatctgggccgttgaccgtgagacgcgggactatgtggcctcgctc
atataa

DBGET integrated database retrieval system