KEGG   Bacillus coagulans 36D1: Bcoa_0035Help
Entry
Bcoa_0035         CDS       T01628                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bag  Bacillus coagulans 36D1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bag02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bag02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(36273..36932)
Genome map
AA seq 219 aa AA seqDB search
MKWEKRKGSEPEKNTQPLSDPVQSGRIAQKKLVCIGTSTGGPRALQTVLSSLPGNLEAPV
LVVQHMPSGFTKSLANRLNAISNIRVKEAEDGEMLKPGAVYIAPGDFHMGVEAHGAHLFI
QLEQSAPVNGHRPAVDKTFESVSMLKNYETLAIIMTGMGSDGTKGLIALKNRGHVRAIAE
AEESCIVYGMPRSAIAAKVVDEVLPLEKIAEAIMKFISD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatgggaaaaacgtaaaggaagcgaaccggaaaaaaacacgcaacctttgtccgat
cctgttcaaagcggacggatagcacagaaaaaattggtttgcatcggaacatcgaccgga
ggcccgcgcgccctgcaaaccgttctttcttccctgcccgggaatttggaagcgcccgtt
ctggttgtccagcatatgccaagcggatttacaaagtcgcttgccaaccggctgaatgcc
atttcaaacatcagggtgaaagaagccgaggatggcgaaatgctcaagccgggggcggtt
tatattgcgcccggggacttccatatgggcgtggaggcgcacggcgcacatctctttatc
cagcttgagcaatccgcgccggttaacgggcacaggccggctgtggataaaacatttgaa
tcggtgagcatgctaaaaaactatgaaacacttgccatcatcatgaccgggatgggttca
gacggaacaaaaggtttgatcgccttaaagaatcgcgggcacgtaagagcgattgccgaa
gcggaagaaagctgcatcgtttacggcatgccgagaagtgccattgccgcgaaagtggtg
gatgaagttttgccgctggaaaaaattgcggaggcaatcatgaaatttattagtgattag

DBGET integrated database retrieval system