KEGG   Bacillus coagulans 36D1: Bcoa_0035Help
Entry
Bcoa_0035         CDS       T01628                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bag  Bacillus coagulans 36D1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bag00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcoa_0035
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bcoa_0035
Enzymes [BR:bag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bcoa_0035
Two-component system [BR:bag02022]
 CheA family
  CheA-CheYBV
   Bcoa_0035
Bacterial motility proteins [BR:bag02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bcoa_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(36273..36932)
Genome map
AA seq 219 aa AA seqDB search
MKWEKRKGSEPEKNTQPLSDPVQSGRIAQKKLVCIGTSTGGPRALQTVLSSLPGNLEAPV
LVVQHMPSGFTKSLANRLNAISNIRVKEAEDGEMLKPGAVYIAPGDFHMGVEAHGAHLFI
QLEQSAPVNGHRPAVDKTFESVSMLKNYETLAIIMTGMGSDGTKGLIALKNRGHVRAIAE
AEESCIVYGMPRSAIAAKVVDEVLPLEKIAEAIMKFISD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatgggaaaaacgtaaaggaagcgaaccggaaaaaaacacgcaacctttgtccgat
cctgttcaaagcggacggatagcacagaaaaaattggtttgcatcggaacatcgaccgga
ggcccgcgcgccctgcaaaccgttctttcttccctgcccgggaatttggaagcgcccgtt
ctggttgtccagcatatgccaagcggatttacaaagtcgcttgccaaccggctgaatgcc
atttcaaacatcagggtgaaagaagccgaggatggcgaaatgctcaagccgggggcggtt
tatattgcgcccggggacttccatatgggcgtggaggcgcacggcgcacatctctttatc
cagcttgagcaatccgcgccggttaacgggcacaggccggctgtggataaaacatttgaa
tcggtgagcatgctaaaaaactatgaaacacttgccatcatcatgaccgggatgggttca
gacggaacaaaaggtttgatcgccttaaagaatcgcgggcacgtaagagcgattgccgaa
gcggaagaaagctgcatcgtttacggcatgccgagaagtgccattgccgcgaaagtggtg
gatgaagttttgccgctggaaaaaattgcggaggcaatcatgaaatttattagtgattag

DBGET integrated database retrieval system