KEGG   Bacillus coagulans 36D1: Bcoa_0071Help
Entry
Bcoa_0071         CDS       T01628                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00020  Citrate cycle (TCA cycle)
bag00640  Propanoate metabolism
bag00660  C5-Branched dibasic acid metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01130  Biosynthesis of antibiotics
bag01200  Carbon metabolism
Module
bag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcoa_0071
   00640 Propanoate metabolism
    Bcoa_0071
   00660 C5-Branched dibasic acid metabolism
    Bcoa_0071
Enzymes [BR:bag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bcoa_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A APH_6_hur
Motif
Other DBs
NCBI-ProteinID: AEO99296
UniProt: G2TJM5
Position
complement(68140..69300)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKEILRKYGVAVPNGKVAFTVDEAVEAAKSLGTQVCVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYAQELLGKTLVTHQTGPEGKEVKRLLIEEGCDIQKEYYVGLVLDRATSR
VVLMASEEGGTEIEEVAAKTPEKIFKETIDPAVGLLPFQARRIAFNINIPAKLVNQAVKF
MTGLYQVFVEKDCSIAEINPLVVTGDGKVMALDAKLNFDSNGLFRQQDVLAYRDLEEEDP
KEIEASKYDLSYVALDGNIGCMVNGAGLAMATMDIIKYYGGDPANFLDVGGGATEEKVTE
AFKIILSDEKVKGIFVNIFGGIMKCDVIASGVVAATKQVGLDIPLVVRLEGTNVELGKKI
LNESGLKIVAAESMADGAQKIVELVS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgagtatcagggcaaagagatcctgagaaaatacggggtcgctgtgccg
aacgggaaagtggccttcaccgtggatgaagcggtggaagcagcgaaatcgctcggtaca
caagtatgtgtggtaaaagcgcaaattcatgccggcggccgcggaaaagcaggcggcgtc
aaagtggcaaaaaatttggatgaggttcgtacatacgcacaggaactgcttggcaaaacg
cttgtgacgcatcagacaggccctgaaggaaaagaagtgaagcgcctcttgatcgaagaa
gggtgcgacattcaaaaagaatactatgtcggccttgttttggaccgtgccacaagccgg
gttgtgctgatggcttctgaagaaggcggcacggaaattgaagaagtggcggcgaaaaca
ccggaaaagatttttaaagaaaccattgacccggcagtcgggctcttgccattccaggcg
cgccgcattgcgttcaacatcaatattcctgctaaacttgtaaatcaggccgttaaattt
atgacaggcctttatcaagtatttgtggaaaaagactgctcgatcgcggaaatcaatccg
cttgttgtaaccggcgacggaaaagtaatggcgctcgatgccaaattgaattttgattcg
aacggcttgttccgccagcaggatgttctggcgtaccgcgatctcgaagaagaagatccg
aaagaaattgaagcgtcgaaatacgatttgagctatgtcgcccttgacggcaatatcggc
tgcatggtaaacggcgccggccttgcgatggcgacaatggacattattaaatattacggc
ggcgatccggccaacttccttgatgtcgggggtggcgcaacggaagaaaaagtaacggaa
gcgtttaaaatcattttatcggatgaaaaagtcaaaggcatttttgtcaacattttcggc
ggcattatgaagtgcgatgtcattgcttccggcgtcgttgcagccacaaaacaagtcgga
ctcgacatcccgctcgttgtccgtcttgaagggaccaatgtggaacttgggaagaaaatt
ttaaacgaatctgggctgaaaattgttgccgctgaatcgatggcagacggcgcgcaaaaa
attgtcgaactggtcagctga

DBGET integrated database retrieval system