KEGG   Bacillus coagulans 36D1: Bcoa_0145Help
Entry
Bcoa_0145         CDS       T01628                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bag  Bacillus coagulans 36D1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bcoa_0145
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcoa_0145
Enzymes [BR:bag01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bcoa_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(147203..148102)
Genome map
AA seq 299 aa AA seqDB search
MQHFLTISDLGNEEILELLEEADAFSKGAVWKAPEPVFAANLFYEPSTRTKCSFEVAERR
IGLELLPFEVGASSVQKGETLYDTVKTLQSIGVKVVVIRHQEDEYYRQLAGLALSIVNAG
DGSGQHPSQCLLDLLTIKQEFGGFRGLKVCIIGDIVHSRVARSNAEALKKLGATVTCSGP
VKWFDPTMHLPYVPVDDGVAEADVVMLLRIQHERHQETAHLTKEAYHRAYGLTVERERMM
KPGSIIMHPAPVNRDVEIATSLVECSRSRIFKQMENGVFARMAILKTILQKEKAVFQTA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcagcattttctgacgatatccgatttgggcaatgaggaaattttggaacttctggaa
gaagccgatgccttttcaaaaggggccgtatggaaagcgccggagccggtttttgcagcc
aatttgttttacgagccgagcacgcggacaaaatgcagctttgaagtggcagaacggcgg
attggccttgagctgcttccgtttgaagtcggggcatcaagcgtgcaaaagggtgaaaca
ttgtacgacacggtgaaaacattgcagtcgatcggcgtcaaagtggtggtgatccgtcac
caggaagatgaatattacaggcagctcgcaggattggcgctttcgattgtcaatgcggga
gacggcagcggtcagcatccgtcccaatgcctgcttgatcttttgacgatcaaacaggaa
ttcggcggcttccgcggcttaaaggtgtgtatcatcggcgatatcgtccacagccgcgtt
gccagatcaaacgccgaagcattgaaaaagcttggtgccaccgtcacgtgttcggggcct
gtaaaatggtttgacccaaccatgcatctcccgtacgttccggtcgatgacggcgtagcg
gaagcagatgtcgtcatgctgctccgcatccaacatgaacgccatcaagaaactgcccat
ctgacaaaagaagcgtaccaccgcgcatacgggctgacggtggaacgggaacggatgatg
aaaccgggcagcatcattatgcacccggcgccggtcaaccgcgatgtcgagattgcaact
agcctcgtggaatgcagccggtcgcggatttttaaacaaatggaaaacggcgtgtttgca
cggatggcgattttaaaaacgattttacagaaagaaaaagcggttttccagacagcttga

DBGET integrated database retrieval system