KEGG   Bacillus coagulans 36D1: Bcoa_0145Help
Entry
Bcoa_0145         CDS       T01628                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00240  Pyrimidine metabolism
bag00250  Alanine, aspartate and glutamate metabolism
bag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bcoa_0145
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcoa_0145
Enzymes [BR:bag01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bcoa_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEO99370
UniProt: G2TJU9
Position
complement(147203..148102)
Genome map
AA seq 299 aa AA seqDB search
MQHFLTISDLGNEEILELLEEADAFSKGAVWKAPEPVFAANLFYEPSTRTKCSFEVAERR
IGLELLPFEVGASSVQKGETLYDTVKTLQSIGVKVVVIRHQEDEYYRQLAGLALSIVNAG
DGSGQHPSQCLLDLLTIKQEFGGFRGLKVCIIGDIVHSRVARSNAEALKKLGATVTCSGP
VKWFDPTMHLPYVPVDDGVAEADVVMLLRIQHERHQETAHLTKEAYHRAYGLTVERERMM
KPGSIIMHPAPVNRDVEIATSLVECSRSRIFKQMENGVFARMAILKTILQKEKAVFQTA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcagcattttctgacgatatccgatttgggcaatgaggaaattttggaacttctggaa
gaagccgatgccttttcaaaaggggccgtatggaaagcgccggagccggtttttgcagcc
aatttgttttacgagccgagcacgcggacaaaatgcagctttgaagtggcagaacggcgg
attggccttgagctgcttccgtttgaagtcggggcatcaagcgtgcaaaagggtgaaaca
ttgtacgacacggtgaaaacattgcagtcgatcggcgtcaaagtggtggtgatccgtcac
caggaagatgaatattacaggcagctcgcaggattggcgctttcgattgtcaatgcggga
gacggcagcggtcagcatccgtcccaatgcctgcttgatcttttgacgatcaaacaggaa
ttcggcggcttccgcggcttaaaggtgtgtatcatcggcgatatcgtccacagccgcgtt
gccagatcaaacgccgaagcattgaaaaagcttggtgccaccgtcacgtgttcggggcct
gtaaaatggtttgacccaaccatgcatctcccgtacgttccggtcgatgacggcgtagcg
gaagcagatgtcgtcatgctgctccgcatccaacatgaacgccatcaagaaactgcccat
ctgacaaaagaagcgtaccaccgcgcatacgggctgacggtggaacgggaacggatgatg
aaaccgggcagcatcattatgcacccggcgccggtcaaccgcgatgtcgagattgcaact
agcctcgtggaatgcagccggtcgcggatttttaaacaaatggaaaacggcgtgtttgca
cggatggcgattttaaaaacgattttacagaaagaaaaagcggttttccagacagcttga

DBGET integrated database retrieval system