KEGG   Bacillus coagulans 36D1: Bcoa_0145Help
Entry
Bcoa_0145         CDS       T01628                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bag  Bacillus coagulans 36D1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bag00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bag00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(147203..148102)
Genome map
AA seq 299 aa AA seqDB search
MQHFLTISDLGNEEILELLEEADAFSKGAVWKAPEPVFAANLFYEPSTRTKCSFEVAERR
IGLELLPFEVGASSVQKGETLYDTVKTLQSIGVKVVVIRHQEDEYYRQLAGLALSIVNAG
DGSGQHPSQCLLDLLTIKQEFGGFRGLKVCIIGDIVHSRVARSNAEALKKLGATVTCSGP
VKWFDPTMHLPYVPVDDGVAEADVVMLLRIQHERHQETAHLTKEAYHRAYGLTVERERMM
KPGSIIMHPAPVNRDVEIATSLVECSRSRIFKQMENGVFARMAILKTILQKEKAVFQTA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcagcattttctgacgatatccgatttgggcaatgaggaaattttggaacttctggaa
gaagccgatgccttttcaaaaggggccgtatggaaagcgccggagccggtttttgcagcc
aatttgttttacgagccgagcacgcggacaaaatgcagctttgaagtggcagaacggcgg
attggccttgagctgcttccgtttgaagtcggggcatcaagcgtgcaaaagggtgaaaca
ttgtacgacacggtgaaaacattgcagtcgatcggcgtcaaagtggtggtgatccgtcac
caggaagatgaatattacaggcagctcgcaggattggcgctttcgattgtcaatgcggga
gacggcagcggtcagcatccgtcccaatgcctgcttgatcttttgacgatcaaacaggaa
ttcggcggcttccgcggcttaaaggtgtgtatcatcggcgatatcgtccacagccgcgtt
gccagatcaaacgccgaagcattgaaaaagcttggtgccaccgtcacgtgttcggggcct
gtaaaatggtttgacccaaccatgcatctcccgtacgttccggtcgatgacggcgtagcg
gaagcagatgtcgtcatgctgctccgcatccaacatgaacgccatcaagaaactgcccat
ctgacaaaagaagcgtaccaccgcgcatacgggctgacggtggaacgggaacggatgatg
aaaccgggcagcatcattatgcacccggcgccggtcaaccgcgatgtcgagattgcaact
agcctcgtggaatgcagccggtcgcggatttttaaacaaatggaaaacggcgtgtttgca
cggatggcgattttaaaaacgattttacagaaagaaaaagcggttttccagacagcttga

DBGET integrated database retrieval system