KEGG   Bacillus coagulans 36D1: Bcoa_0221Help
Entry
Bcoa_0221         CDS       T01628                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00010  Glycolysis / Gluconeogenesis
bag00020  Citrate cycle (TCA cycle)
bag00620  Pyruvate metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01130  Biosynthesis of antibiotics
bag01200  Carbon metabolism
Module
bag_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcoa_0221
   00020 Citrate cycle (TCA cycle)
    Bcoa_0221
   00620 Pyruvate metabolism
    Bcoa_0221
Enzymes [BR:bag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bcoa_0221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEO99446
UniProt: G2TLE4
Position
complement(218853..220166)
Genome map
AA seq 437 aa AA seqDB search
MSFEFRLPDIGEGIHEGEIVKWFIKPGDKVSEDDVLCEVQNDKSVVEIPSPVEGTVEDIL
VEEGSVAVVGDVLVKFDAPGYENLKFKGDHGQDQKEEAAESAKPEPAKPEPAKQETAETA
KPAEKEAEHGSESADRRVIAMPSVRKYAREKGVDIQLVSGTGKNGRVLREDIDAYVNGPQ
QPEAETGKTEAQAPASQNAIPEGEFPETREPMSGIRKVIAKAMVNSKQTAPHVTLMDDVD
VTALVAHRKKFKEIAAEKGIKLTFLPYVVKALVSTLREYPVLNSSIDDETNEIIHKHYYN
IGIAADTERGLLVPVVKHADRKPVFAVSKEINELAEKARDGKLAPNEMKGASITISNIGS
AGGQWFTPVINRPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRIIDGATAQNAL
NHIKRLLHDPELLLMEA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgtcatttgaattcaggctgccggatatcggcgaagggatccacgaaggcgagattgta
aaatggtttattaaaccgggcgataaagtttcggaagatgatgtgctttgtgaagtgcaa
aatgacaaatcggttgtcgaaattccgtcccctgtggaagggactgttgaagacattctt
gttgaagaagggagcgtcgcagttgtcggcgacgtccttgtaaaattcgatgcgcccgga
tatgaaaatcttaaatttaaaggggatcatgggcaagatcagaaagaagaggcggcagaa
agtgcaaaaccggaaccggccaaaccggaaccggcaaaacaggaaacagctgaaactgcc
aagcctgctgaaaaagaagcagaacatggctccgaatccgcggatcgccgcgtgatcgca
atgccatccgtacggaaatatgcccgggaaaaaggcgtcgatatccagcttgtgtccgga
accggaaaaaacggccgcgtgctccgcgaagatatcgatgcgtatgtgaacgggccgcag
cagccggaagcggaaaccggcaaaaccgaagcacaggcacctgcttcccagaatgctatt
cctgaaggggaattccctgaaacacgtgaaccgatgagcggcatccgcaaagtgattgca
aaagcgatggtcaactcgaaacaaaccgcgccgcatgttacgctgatggatgatgtcgat
gtgacggcactggtcgcgcaccggaaaaaattcaaagagatcgcggcagaaaaaggcatc
aaactgactttcctgccgtatgtcgtaaaagcgctcgtcagcacgctgcgggaatacccg
gttttaaatagttcgattgatgatgaaacgaatgaaatcatccataagcattattacaat
atcgggattgccgctgatacggagcgcggcttgcttgtgccggtcgtcaaacacgccgac
cgcaaaccggtatttgcggtttccaaagaaattaatgaactggctgaaaaagcaagagat
ggaaagcttgccccgaacgaaatgaaaggcgcttccattacgatttccaatatcggttcc
gccggcgggcaatggtttacaccggttatcaaccgtccggaagtggccattttaggaatc
ggccggattgcagaaaagccggtcgttaaaaacggtgaaattgttgcagcgcctgtactg
gcgttgtcgctcagttttgaccaccgtatcatcgatggtgccaccgcacaaaatgcgtta
aatcatatcaaacgtttgttgcatgatccagaacttttattaatggaggcgtaa

DBGET integrated database retrieval system