KEGG   Bacillus coagulans 36D1: Bcoa_0474Help
Entry
Bcoa_0474         CDS       T01628                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bag  Bacillus coagulans 36D1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcoa_0474
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Bcoa_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483682..485094
Genome map
AA seq 470 aa AA seqDB search
MKSVVIIGGGITGLTALYELHKQIEKTGAQVSLALVEENPEAGGKLRTVRKEGFIMETGA
DSIVARKKGVAGFLKELGLENRIRHNATGISYLYREDGLKPIPREAVFGIPASLDALFGS
ELVSTKGKLTALKDLFTKNHSFTKDSSAGEFLEAFFGKELVEKQIAPVLSGVYSGNLYEL
TLATTMPFLVDYKNRYGSIMKGLSEHKQTFLSPEKKKFVSFKNGLSELADRLEEKAAGAD
IIKGVKAVALERHEKGYTVVLSDGRRLKADVVVLAVPHAAAKKLLANPALDKEWDQFKAA
SVITVYLGFDVPDAVLPKDGTGFIVSGGSGLVCNACTWTSRKWPHTSKNGRLLLRLFYKD
ADAALFNRLNAMDQEGLIETALKDVRQALGISAQPVAAEVTKWLGKMPKYDLHHRQRVEA
LTKKLSASDPDVVLAGCSYYGVGIADCIVNGKETAGKVMEKLREQGSLNV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcggtcgtgatcattggcgggggcattacgggccttaccgcattgtacgagctt
cataaacagattgaaaaaacaggggcacaggtatccttggcccttgtggaagaaaatccg
gaagccggcggaaagctccgtaccgtccggaaagagggttttattatggaaacgggcgcg
gattcgatcgttgcccgcaaaaaaggggtagccgggtttttgaaagaacttgggcttgaa
aaccggatccgccacaatgctaccggcatctcgtatctttaccgggaagatgggttaaaa
ccgattccgcgagaggcagtgtttggcattccggcaagtttggatgccctttttggcagt
gaacttgtttcaacgaaagggaaactgacggcgctgaaagatttgtttacgaaaaaccat
tcttttacaaaagacagttcagccggagaatttttggaggcttttttcggcaaagaactg
gtggagaaacaaattgcgccggtgctgtccggcgtttactccggcaatttgtatgaactg
acattggcgacaacaatgccgtttcttgtcgattataaaaatcggtatggcagcattatg
aaaggtttgtccgaacataagcaaactttcttgtctcctgagaagaaaaaatttgtatcg
tttaaaaacggtttgtccgaactggctgaccgccttgaggaaaaggcagcgggcgctgac
atcataaaaggcgtgaaagcagttgcgcttgaacggcacgaaaaaggctatactgttgta
ttgtcggacgggcgcaggcttaaagcagatgtggtggtgcttgccgtaccgcatgctgca
gcgaagaaactgcttgcgaaccctgctttggataaggaatgggatcagtttaaggccgct
tcggtgatcaccgtttatcttggttttgacgtgccggatgcagtcttgccgaaagacggg
acaggttttattgtttctggcggaagtgggctcgtttgcaatgcctgcacatggacaagc
cggaaatggccgcacacgtcgaaaaatggacgcctgctgttgcgcttgttttataaagac
gcggatgccgcactgtttaaccggctgaatgcgatggatcaggagggcctgattgaaacg
gcgctgaaagatgtgcggcaggcgctcgggataagtgcacagccagtggcagcggaagtg
acaaaatggctgggcaagatgccgaagtacgatttgcaccaccgtcagagggtagaagcg
ctaaccaaaaagctatcagcaagcgacccggacgtggtgctcgccggttgctcttactac
ggcgtcggcatcgccgattgcatcgtgaatggaaaagaaacggcgggaaaggtaatggaa
aaactaagggagcagggcagtttaaatgtgtaa

DBGET integrated database retrieval system