KEGG   Bacillus coagulans 36D1: Bcoa_0573Help
Entry
Bcoa_0573         CDS       T01628                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bag  Bacillus coagulans 36D1
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bag00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bag00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
599829..602021
Genome map
AA seq 730 aa AA seqDB search
MISFEEQTKTFHLQNDEVSYLLQVDAFGYVEHLYWGKPVRAYHGGRAYPRIGRSFSPNPP
GAKDRKFSLDTVLQEFPGYGNGDFREPAHIIRHADGSTVTDFRYRAYDILKGKPALPGLP
ATFANQNEAETLKIMLEDKLTGLQLTLLYTIFRDFPAISRAAVLTNGGNKPVRIERLMSL
NVDFPAGSFELLHLPGAHKRERQIAREIVTDGIKRIDSKRGASSHQENPFLALVRPETTE
FQGEAYAVNLVYSGNFAGMVQQDQFGQVRFGIGLNDFGFSWTLEPGDTFYSPEAVMVYSR
DGLNGMSQTFHTLYRRHLLRGKHKDAERPVLINNWEATYFRFHDEKLLELADEAQKLGIE
LFVLDDGWFGHRDNDRSSLGDWYEYAGKIRMGLKNLAEEIHKRGMQFGLWFEPEMVSRDS
DLFREHPDWALQIPGRGLSEGRSQYVLDFSRRDVRENIFRQMTDILDHVHVDYIKWDMNR
HMTEVHSALLEPENQGETAHRYMLGLYDFLEKLTSRYPDILFESCSGGGGRFDPGMLYYM
PQTWTSDNTDAADRLEIQYGTSLAYPPVTMGAHVSAVPNHQTGRVTPLSTRGDVAMGGNF
GYELDLTKCTEDEKAVIREQIAFYKAHRQLFQFGRFYRLISPFEGNSAAWQFVSPDRNHT
IAYFFNVLSEAAGPLKILKLAGLDPDKNYRHIETDKIYGGDELMNIGLYLPLFNKQDFAS
YKMEFKVVYE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgattagttttgaggaacaaacgaaaactttccatttgcaaaatgatgaagtgagttac
cttttacaagtggatgcattcggctacgtggaacatctgtattggggaaaaccggtgagg
gcctatcacggagggcgcgcctatccgcgcattggccgcagtttttccccgaacccgccc
ggtgcaaaagaccgcaaattttcgcttgatacggtactgcaggaattcccgggttacggc
aacggcgatttccgtgagccggcacatattatccgacatgcggacgggtcaacggtcacg
gacttccgctaccgggcgtatgacattttaaagggcaagccggcgcttcccgggcttccc
gctacttttgccaatcaaaatgaagccgaaacgttgaaaatcatgttggaagacaagctt
acaggccttcaattaacgcttttatataccatctttcgcgattttccggcgatttcccgc
gcggctgtgctgacaaacggcggaaacaaacctgttcgaattgaacgcttgatgagcctg
aatgtcgatttcccagccggaagttttgaacttttgcatctccccggcgcccataaacgc
gaacggcaaatagcaagagaaatcgtaacggacggcatcaagcggatagacagcaagcgc
ggcgccagcagccatcaggaaaatccgtttttggcgcttgtccggcctgaaacaacggaa
ttccaaggtgaagcatatgcagtgaacctcgtttacagcggcaattttgccggaatggtg
cagcaggaccagttcgggcaggtacgctttggaatcgggctgaatgatttcgggttcagc
tggacgttggagccgggtgacactttttattcccctgaagcggtgatggtatacagcaga
gacgggctgaacgggatgtcgcaaacgtttcacacgctctaccgccgccaccttttgcgc
ggcaagcataaagatgcggaacgccctgtattgatcaacaactgggaagcgacctatttc
cgatttcatgatgaaaaactgcttgaactcgccgacgaggcgcaaaagctcggcattgag
ctgtttgtgctggatgacggctggttcggccaccgggacaatgatcgcagttctttaggg
gactggtatgaatacgccggaaaaatccggatggggctcaaaaacctggcggaagaaatc
cataaacgcgggatgcaattcgggctctggtttgaaccggaaatggtttcgcgggacagc
gaccttttccgtgaacatccggactgggcactgcaaattccgggccgcgggctttctgaa
gggcgctcccaatatgtgctcgattttagccgtagggatgtgcgcgaaaacattttccgg
cagatgacagacattctggatcatgtccatgttgattacatcaaatgggatatgaaccgc
catatgacagaagtccattccgccctgctggagccggaaaaccagggagagaccgcccac
cgctatatgcttgggctgtatgactttttagaaaagttgacgtcgcgttaccctgatatt
ttgtttgaaagctgttccggcggcggcgggcgttttgatccgggcatgctgtattatatg
ccgcaaacgtggacgagcgataataccgatgcggccgaccgtctggaaatccagtacggc
acaagcctcgcctacccaccggttacgatgggcgcgcatgtctcggccgttccgaaccac
caaaccggccgggttacgccgttatcgacgcgcggtgacgtggcaatgggcggcaatttc
ggctatgagttggatttgacaaaatgcacggaagatgaaaaagcggtgatccgggaacag
attgcattttacaaggcacaccggcaattgttccagtttggccggttttaccgcctgata
agcccgtttgaaggcaacagcgccgcctggcaatttgtctcaccggaccgcaaccatacc
attgcctattttttcaacgtactgtctgaagcagccggcccgttgaaaatattaaaactg
gcaggccttgacccggacaaaaactaccggcatattgaaacagacaaaatctacggcggc
gacgaactgatgaacatcgggctgtatttgccattgtttaacaaacaggactttgcaagt
tacaagatggagtttaaggtggtatacgagtaa

DBGET integrated database retrieval system