KEGG   Bacillus coagulans 36D1: Bcoa_0573Help
Entry
Bcoa_0573         CDS       T01628                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bag  Bacillus coagulans 36D1
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bcoa_0573
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bcoa_0573
   00600 Sphingolipid metabolism
    Bcoa_0573
Enzymes [BR:bag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Bcoa_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
599829..602021
Genome map
AA seq 730 aa AA seqDB search
MISFEEQTKTFHLQNDEVSYLLQVDAFGYVEHLYWGKPVRAYHGGRAYPRIGRSFSPNPP
GAKDRKFSLDTVLQEFPGYGNGDFREPAHIIRHADGSTVTDFRYRAYDILKGKPALPGLP
ATFANQNEAETLKIMLEDKLTGLQLTLLYTIFRDFPAISRAAVLTNGGNKPVRIERLMSL
NVDFPAGSFELLHLPGAHKRERQIAREIVTDGIKRIDSKRGASSHQENPFLALVRPETTE
FQGEAYAVNLVYSGNFAGMVQQDQFGQVRFGIGLNDFGFSWTLEPGDTFYSPEAVMVYSR
DGLNGMSQTFHTLYRRHLLRGKHKDAERPVLINNWEATYFRFHDEKLLELADEAQKLGIE
LFVLDDGWFGHRDNDRSSLGDWYEYAGKIRMGLKNLAEEIHKRGMQFGLWFEPEMVSRDS
DLFREHPDWALQIPGRGLSEGRSQYVLDFSRRDVRENIFRQMTDILDHVHVDYIKWDMNR
HMTEVHSALLEPENQGETAHRYMLGLYDFLEKLTSRYPDILFESCSGGGGRFDPGMLYYM
PQTWTSDNTDAADRLEIQYGTSLAYPPVTMGAHVSAVPNHQTGRVTPLSTRGDVAMGGNF
GYELDLTKCTEDEKAVIREQIAFYKAHRQLFQFGRFYRLISPFEGNSAAWQFVSPDRNHT
IAYFFNVLSEAAGPLKILKLAGLDPDKNYRHIETDKIYGGDELMNIGLYLPLFNKQDFAS
YKMEFKVVYE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgattagttttgaggaacaaacgaaaactttccatttgcaaaatgatgaagtgagttac
cttttacaagtggatgcattcggctacgtggaacatctgtattggggaaaaccggtgagg
gcctatcacggagggcgcgcctatccgcgcattggccgcagtttttccccgaacccgccc
ggtgcaaaagaccgcaaattttcgcttgatacggtactgcaggaattcccgggttacggc
aacggcgatttccgtgagccggcacatattatccgacatgcggacgggtcaacggtcacg
gacttccgctaccgggcgtatgacattttaaagggcaagccggcgcttcccgggcttccc
gctacttttgccaatcaaaatgaagccgaaacgttgaaaatcatgttggaagacaagctt
acaggccttcaattaacgcttttatataccatctttcgcgattttccggcgatttcccgc
gcggctgtgctgacaaacggcggaaacaaacctgttcgaattgaacgcttgatgagcctg
aatgtcgatttcccagccggaagttttgaacttttgcatctccccggcgcccataaacgc
gaacggcaaatagcaagagaaatcgtaacggacggcatcaagcggatagacagcaagcgc
ggcgccagcagccatcaggaaaatccgtttttggcgcttgtccggcctgaaacaacggaa
ttccaaggtgaagcatatgcagtgaacctcgtttacagcggcaattttgccggaatggtg
cagcaggaccagttcgggcaggtacgctttggaatcgggctgaatgatttcgggttcagc
tggacgttggagccgggtgacactttttattcccctgaagcggtgatggtatacagcaga
gacgggctgaacgggatgtcgcaaacgtttcacacgctctaccgccgccaccttttgcgc
ggcaagcataaagatgcggaacgccctgtattgatcaacaactgggaagcgacctatttc
cgatttcatgatgaaaaactgcttgaactcgccgacgaggcgcaaaagctcggcattgag
ctgtttgtgctggatgacggctggttcggccaccgggacaatgatcgcagttctttaggg
gactggtatgaatacgccggaaaaatccggatggggctcaaaaacctggcggaagaaatc
cataaacgcgggatgcaattcgggctctggtttgaaccggaaatggtttcgcgggacagc
gaccttttccgtgaacatccggactgggcactgcaaattccgggccgcgggctttctgaa
gggcgctcccaatatgtgctcgattttagccgtagggatgtgcgcgaaaacattttccgg
cagatgacagacattctggatcatgtccatgttgattacatcaaatgggatatgaaccgc
catatgacagaagtccattccgccctgctggagccggaaaaccagggagagaccgcccac
cgctatatgcttgggctgtatgactttttagaaaagttgacgtcgcgttaccctgatatt
ttgtttgaaagctgttccggcggcggcgggcgttttgatccgggcatgctgtattatatg
ccgcaaacgtggacgagcgataataccgatgcggccgaccgtctggaaatccagtacggc
acaagcctcgcctacccaccggttacgatgggcgcgcatgtctcggccgttccgaaccac
caaaccggccgggttacgccgttatcgacgcgcggtgacgtggcaatgggcggcaatttc
ggctatgagttggatttgacaaaatgcacggaagatgaaaaagcggtgatccgggaacag
attgcattttacaaggcacaccggcaattgttccagtttggccggttttaccgcctgata
agcccgtttgaaggcaacagcgccgcctggcaatttgtctcaccggaccgcaaccatacc
attgcctattttttcaacgtactgtctgaagcagccggcccgttgaaaatattaaaactg
gcaggccttgacccggacaaaaactaccggcatattgaaacagacaaaatctacggcggc
gacgaactgatgaacatcgggctgtatttgccattgtttaacaaacaggactttgcaagt
tacaagatggagtttaaggtggtatacgagtaa

DBGET integrated database retrieval system