KEGG   Bacillus coagulans 36D1: Bcoa_0591Help
Entry
Bcoa_0591         CDS       T01628                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bag  Bacillus coagulans 36D1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
623206..623970
Genome map
AA seq 254 aa AA seqDB search
MHEYYPVLSGAESFFIKGNEIGILISHGFNGTPQSVRFLGEALASDGFTVCAPRLKGHGT
HILDMERCTYKDWIASLEEGYQLLKRHCHDIFVIGQSMGGTLALHLAEKHPDIRGIVCIN
AAIQSIPELEKCLAKGRFIQEGPPDIKAAGVHEISYEKVPVASIRELLSVMWETRENLSA
IHCPALLFQSTEDHVVPPENTEYIAAHIHASRKKIVPLRNSYHVATMDHEKEWIAAQCSL
FVQEIAHIETRTEI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaatactatcccgttctttcgggtgcagaatccttttttataaaaggaaatgaa
attggcattctcatctcgcatggattcaacggcaccccgcagagcgtccgctttttggga
gaggcactggcatcggacgggtttacggtttgcgcgccaagattaaagggacacgggacg
catatcctggacatggaacgctgcacttacaaagactggattgctagccttgaagaaggt
tatcagctgctgaaacggcattgccatgatatttttgttattggccagtcaatgggtggc
acactggctttgcatctcgcggaaaaacacccggatatccggggaatagtgtgtatcaac
gcggctatccaaagcattcctgaactggaaaaatgcctggcgaaaggacggtttattcaa
gagggcccgccggatattaaagcagcgggcgtgcatgaaatttcatatgaaaaagtgccg
gtggcttccatccgtgagcttctgtccgtgatgtgggaaacgcgggaaaacctctccgcc
atccattgccccgcacttttgttccaatcaacagaagaccatgtcgtgcctcctgaaaat
acagagtatattgccgcacatattcatgccagccggaaaaaaatcgtaccgctccgcaac
tcttatcatgtcgcaacaatggatcatgaaaaagaatggattgcggcccaatgttcatta
tttgttcaagaaattgcgcatatcgaaacccgtacggaaatatga

DBGET integrated database retrieval system