KEGG   Bacillus coagulans 36D1: Bcoa_0624Help
Entry
Bcoa_0624         CDS       T01628                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bag  Bacillus coagulans 36D1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcoa_0624
   00052 Galactose metabolism
    Bcoa_0624
   00500 Starch and sucrose metabolism
    Bcoa_0624
   00520 Amino sugar and nucleotide sugar metabolism
    Bcoa_0624
Enzymes [BR:bag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcoa_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(657041..657925)
Genome map
AA seq 294 aa AA seqDB search
MQKIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIDSGIEDIIIVTGKG
KRAIEDHFDHAFELEDNLIAKKKFDLLEKVRQPAEVDIHYIRQKEPKGLGHAIWCARKFI
GNEPFAVLLGDDIIQAEPPCLKQMIDVYEQVHSSVIAVMEVAREETNRYGIIDPLDQKGR
IYDVKGFVEKPKVEEAPSNVAIIGRYILTPEIFDFLSLQKTGSGGEIQLTDAIEQLNEIQ
KVYAYAYEGKRYDVGEKFGFIKSTIEMALSREDLRDDLLRYLEDLQWRIQNHQI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatcaagaaggcgattatcccggcagcggggcttggaacacgtttcctgccg
gcgacgaaggcaatgccgaaagaaatgctgccaattgtcgataagccgacaatccaatat
attgtggaagaggccattgattccggcattgaagatatcatcatcgtaaccgggaaaggg
aaacgggcgattgaagaccattttgaccacgcatttgagcttgaggacaatttgatcgca
aagaaaaaatttgatctgcttgaaaaagtgcgccagcctgcagaagtggatatccattat
atccggcaaaaggaaccgaaaggactgggccacgcgatttggtgtgcgcgcaaatttatt
gggaatgaaccgtttgccgtgctcctcggtgatgatattattcaggctgaaccgccttgc
ctgaaacaaatgatcgatgtttatgaacaggtccattccagcgtgattgccgtcatggaa
gtcgcgcgtgaggaaacaaaccgttacgggattattgacccgctcgatcaaaagggaaga
atttatgatgtgaaaggctttgtagaaaagccgaaagtggaggaagcgccgtcaaatgtc
gccattatcgggcggtatattttaacaccggagatttttgatttcctttcattgcagaag
acgggatcaggcggtgaaatccagctgaccgatgccattgaacaattgaatgaaatccaa
aaagtgtatgcctatgcttatgaagggaaacgctacgacgtcggcgaaaaattcgggttt
atcaaatcgacgattgaaatggcgctttcccgggaagatctgcgcgatgatttgctccgg
tatttggaagatttgcaatggagaattcaaaaccatcagatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system