KEGG   Bacillus coagulans 36D1: Bcoa_0624Help
Entry
Bcoa_0624         CDS       T01628                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00040  Pentose and glucuronate interconversions
bag00052  Galactose metabolism
bag00500  Starch and sucrose metabolism
bag00520  Amino sugar and nucleotide sugar metabolism
bag01100  Metabolic pathways
bag01130  Biosynthesis of antibiotics
Module
bag_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcoa_0624
   00052 Galactose metabolism
    Bcoa_0624
   00500 Starch and sucrose metabolism
    Bcoa_0624
   00520 Amino sugar and nucleotide sugar metabolism
    Bcoa_0624
Enzymes [BR:bag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcoa_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEO99843
UniProt: G2TQJ5
Position
complement(657041..657925)
Genome map
AA seq 294 aa AA seqDB search
MQKIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIDSGIEDIIIVTGKG
KRAIEDHFDHAFELEDNLIAKKKFDLLEKVRQPAEVDIHYIRQKEPKGLGHAIWCARKFI
GNEPFAVLLGDDIIQAEPPCLKQMIDVYEQVHSSVIAVMEVAREETNRYGIIDPLDQKGR
IYDVKGFVEKPKVEEAPSNVAIIGRYILTPEIFDFLSLQKTGSGGEIQLTDAIEQLNEIQ
KVYAYAYEGKRYDVGEKFGFIKSTIEMALSREDLRDDLLRYLEDLQWRIQNHQI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatcaagaaggcgattatcccggcagcggggcttggaacacgtttcctgccg
gcgacgaaggcaatgccgaaagaaatgctgccaattgtcgataagccgacaatccaatat
attgtggaagaggccattgattccggcattgaagatatcatcatcgtaaccgggaaaggg
aaacgggcgattgaagaccattttgaccacgcatttgagcttgaggacaatttgatcgca
aagaaaaaatttgatctgcttgaaaaagtgcgccagcctgcagaagtggatatccattat
atccggcaaaaggaaccgaaaggactgggccacgcgatttggtgtgcgcgcaaatttatt
gggaatgaaccgtttgccgtgctcctcggtgatgatattattcaggctgaaccgccttgc
ctgaaacaaatgatcgatgtttatgaacaggtccattccagcgtgattgccgtcatggaa
gtcgcgcgtgaggaaacaaaccgttacgggattattgacccgctcgatcaaaagggaaga
atttatgatgtgaaaggctttgtagaaaagccgaaagtggaggaagcgccgtcaaatgtc
gccattatcgggcggtatattttaacaccggagatttttgatttcctttcattgcagaag
acgggatcaggcggtgaaatccagctgaccgatgccattgaacaattgaatgaaatccaa
aaagtgtatgcctatgcttatgaagggaaacgctacgacgtcggcgaaaaattcgggttt
atcaaatcgacgattgaaatggcgctttcccgggaagatctgcgcgatgatttgctccgg
tatttggaagatttgcaatggagaattcaaaaccatcagatctga

DBGET integrated database retrieval system