KEGG   Bacillus coagulans 36D1: Bcoa_0630Help
Entry
Bcoa_0630         CDS       T01628                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcoa_0630
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcoa_0630
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bcoa_0630
Enzymes [BR:bag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bcoa_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
664347..665411
Genome map
AA seq 354 aa AA seqDB search
MNQWPGLLKQYKSFLPVTDKTPELTLFEGNTPLIPFARLSEKLGVELYGKFEGLNPTGSF
KDRGMVMAVAKAIENGSRSVICASTGNTSASAAAYAAKAGIRAIIVIPSGKIALGKLAQA
VMYGAEIVEIDGNFDQALKIVRKVSETSPVTLVNSVNPYRLEGQKTAAFEICEQLGSAPD
VLAIPVGNAGNISAYWKGFKEFNEKFETGLPEMHGFEAEGAAAIVRDRVIENPETVATAI
RIGNPASWKLAVNARDESGGVIDSVSDPEILDAFRLLARNEGTFAEPGSCASIAGVIKQV
KTGQIKKGSKVVAVLTGNGLKDPQTAMSQVEVRPAVLPATEEAVTDYLSNVIHV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatggccaggattactcaaacagtacaaatcatttttacccgtcacagacaaa
acaccggaactgacattatttgaaggcaatacgccgcttatcccgtttgcccgcctctcg
gaaaagctcggcgtggaattgtacggaaaatttgaaggtttgaacccaaccggctctttt
aaagaccgcggcatggtgatggcggttgcgaaagcgatcgaaaacggcagcaggtccgtt
atctgcgcctccaccggcaacacttccgcttctgcggccgcctatgccgcaaaagccgga
atccgggcaatcatcgtgatcccgagcggaaaaatcgcgcttggcaaactggcacaggcc
gttatgtacggcgctgaaatcgtggaaattgatggcaattttgaccaggcgcttaaaatc
gtcaggaaagtaagcgaaacttcgcctgttacacttgtaaactcggttaacccttaccgg
ctggaaggccaaaaaacagcggctttcgagatttgtgagcagctgggttcagcacccgat
gtccttgccatcccggtcggcaatgccggaaacatcagcgcgtattggaaaggattcaaa
gagttcaatgagaaattcgaaaccggcctgccggaaatgcacggctttgaagcggaaggc
gcagctgccatcgtccgggatcgggtgatcgaaaacccggaaacggtcgccaccgcgatc
cggatcggcaacccggcaagctggaaactggctgtcaacgcccgcgatgaatcaggcggc
gtgattgactcagtgtcagacccggaaatccttgatgcgttccggctgctcgcccgcaat
gaaggaacgttcgccgaaccgggttcatgtgcgtccatcgccggtgtcatcaagcaggtc
aaaacgggacagatcaaaaaaggaagcaaagtggttgctgtcctgaccggaaacgggcta
aaagacccgcaaaccgccatgtcccaagtcgaagtccggcctgccgtgctgccggcaacg
gaggaagccgtgacagattatctttcgaatgtgatccatgtatga

DBGET integrated database retrieval system