KEGG   Bacillus coagulans 36D1: Bcoa_0640Help
Entry
Bcoa_0640         CDS       T01628                                 

Definition
citrate synthase
Orthology
K01647  
citrate synthase [EC:2.3.3.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcoa_0640
   01210 2-Oxocarboxylic acid metabolism
    Bcoa_0640
   01230 Biosynthesis of amino acids
    Bcoa_0640
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcoa_0640
   00630 Glyoxylate and dicarboxylate metabolism
    Bcoa_0640
Enzymes [BR:bag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Bcoa_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(675003..676124)
Genome map
AA seq 373 aa AA seqDB search
MGNTTQFVPGLEGVVAVETELSFLDTAQGEIVLKGYDLIELSKTKSYLDIVHLLLEGTLP
NDAEKKALEESLKKNYRIPEAVLDILKLLPASTHPMDALRTGVSALAGYDENLLDRSRKA
NLNRAYHLLGNVPNIVANSYHLLNGEDPVEPRQDLSYSANFLYMITGKVPSEKEEKIFDR
SLVLYSEHELPNSTFTARVIASTLSDLYGALTGAVASLKGHLHGGANEAVMEMLKEAGTV
EKFEEMLYTKLKNKEKVMGFGHRVYMKKMDPRALMMKEALKELCAEKGDHSLLEMCEAGE
KIMAQEKGLYPNLDYYAAPVYWMLGIPIPLYTPIFFSSRTVGLCAHVMEQHENNRLFRPR
VQYKGPRGLHPQD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatacgacacagtttgtgccggggcttgaaggggttgtcgctgttgaaacggag
ctttcttttcttgacacggcccagggcgagatcgttttaaaggggtatgacttgattgag
ttgtcgaaaacgaaaagctatctggacatcgtgcatttgcttcttgaaggcacgctccca
aatgatgccgagaaaaaagcgttggaagaaagtttaaagaaaaactaccggattccggaa
gccgtgctggacattttgaagctattgccggcatccacccacccgatggatgcgctccgt
acaggggtttcagcgctggcggggtatgatgaaaacctgctggatcgctcccgcaaagcc
aatttaaaccgtgcataccatttgctcgggaatgtgccgaacattgtcgcaaacagctac
catcttttaaacggcgaagacccggttgaaccgcggcaggatttgtcgtacagcgccaat
ttcctgtacatgatcaccgggaaagtcccttcggaaaaggaagaaaagattttcgaccgt
tcccttgtcctgtacagcgaacatgaactgccgaattcgacttttacggcaagggtcatt
gcgtccaccttgtccgatttatacggggcgttaacaggcgcagtggcatcgctcaagggc
catctgcacgggggtgccaatgaagcggtgatggagatgctgaaagaagccggcacggtg
gaaaaatttgaagaaatgctttatacgaaactgaaaaacaaagaaaaagtaatggggttc
ggccaccgcgtctacatgaaaaagatggacccgcgcgccttgatgatgaaagaagcgctg
aaagaactttgtgcggaaaaaggggatcattcgctgcttgaaatgtgcgaagccggggaa
aaaatcatggcgcaggaaaaagggctctatccgaacctcgattattatgcagccccggtt
tattggatgctcggcattccgattccgctttatacgccgatctttttcagttcaagaacg
gtcgggctgtgcgcacatgtgatggagcagcatgaaaacaaccgcctgttccgtccgcgc
gtccaatacaaaggcccgcgcggtttgcatccgcaagattaa

DBGET integrated database retrieval system