KEGG   Bacillus coagulans 36D1: Bcoa_0640Help
Entry
Bcoa_0640         CDS       T01628                                 

Definition
citrate synthase
Orthology
K01647  
citrate synthase [EC:2.3.3.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bag01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:bag01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bag01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bag00020]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bag00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(675003..676124)
Genome map
AA seq 373 aa AA seqDB search
MGNTTQFVPGLEGVVAVETELSFLDTAQGEIVLKGYDLIELSKTKSYLDIVHLLLEGTLP
NDAEKKALEESLKKNYRIPEAVLDILKLLPASTHPMDALRTGVSALAGYDENLLDRSRKA
NLNRAYHLLGNVPNIVANSYHLLNGEDPVEPRQDLSYSANFLYMITGKVPSEKEEKIFDR
SLVLYSEHELPNSTFTARVIASTLSDLYGALTGAVASLKGHLHGGANEAVMEMLKEAGTV
EKFEEMLYTKLKNKEKVMGFGHRVYMKKMDPRALMMKEALKELCAEKGDHSLLEMCEAGE
KIMAQEKGLYPNLDYYAAPVYWMLGIPIPLYTPIFFSSRTVGLCAHVMEQHENNRLFRPR
VQYKGPRGLHPQD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatacgacacagtttgtgccggggcttgaaggggttgtcgctgttgaaacggag
ctttcttttcttgacacggcccagggcgagatcgttttaaaggggtatgacttgattgag
ttgtcgaaaacgaaaagctatctggacatcgtgcatttgcttcttgaaggcacgctccca
aatgatgccgagaaaaaagcgttggaagaaagtttaaagaaaaactaccggattccggaa
gccgtgctggacattttgaagctattgccggcatccacccacccgatggatgcgctccgt
acaggggtttcagcgctggcggggtatgatgaaaacctgctggatcgctcccgcaaagcc
aatttaaaccgtgcataccatttgctcgggaatgtgccgaacattgtcgcaaacagctac
catcttttaaacggcgaagacccggttgaaccgcggcaggatttgtcgtacagcgccaat
ttcctgtacatgatcaccgggaaagtcccttcggaaaaggaagaaaagattttcgaccgt
tcccttgtcctgtacagcgaacatgaactgccgaattcgacttttacggcaagggtcatt
gcgtccaccttgtccgatttatacggggcgttaacaggcgcagtggcatcgctcaagggc
catctgcacgggggtgccaatgaagcggtgatggagatgctgaaagaagccggcacggtg
gaaaaatttgaagaaatgctttatacgaaactgaaaaacaaagaaaaagtaatggggttc
ggccaccgcgtctacatgaaaaagatggacccgcgcgccttgatgatgaaagaagcgctg
aaagaactttgtgcggaaaaaggggatcattcgctgcttgaaatgtgcgaagccggggaa
aaaatcatggcgcaggaaaaagggctctatccgaacctcgattattatgcagccccggtt
tattggatgctcggcattccgattccgctttatacgccgatctttttcagttcaagaacg
gtcgggctgtgcgcacatgtgatggagcagcatgaaaacaaccgcctgttccgtccgcgc
gtccaatacaaaggcccgcgcggtttgcatccgcaagattaa

DBGET integrated database retrieval system