KEGG   Bacillus coagulans 36D1: Bcoa_0772Help
Entry
Bcoa_0772         CDS       T01628                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bag  Bacillus coagulans 36D1
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bcoa_0772
Enzymes [BR:bag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bcoa_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(825060..827057)
Genome map
AA seq 665 aa AA seqDB search
MLKKQEKFYYGGDYNPEQWDESVWKEDMRLMKKAGVNYVSINIFSWARLQPDEETYDFST
LDKIMDMLAENGIGADLATATAAPPAWLSRKYPDSLPVDKDGARFLPGSRQHYCPNSKDY
ARLAAKLVRKIAERYKNHPALVMWHVNNEYGCHIAECYCDNCKKAFQTWLKEKYSTIENL
NKSWSTDFWSQRYYEWEEICLPGKTPTFANPMQQLDYKAFMDDSLLALYKMERDILKAYT
PDVPVMTNLMGLHKPVDGFHWAKEMDLVTWDAYPDPFDRIPYAQFMAHDLMRSLKKQPFL
LMEQAAGAVNWRAQNAVKTPGQMRLWSYEAAAHGADGIMFFQWRASQGGAEKFHSGMVPH
SGDEESRNFREVVQLGNELKNLEKVTGSAYAADVAIVFDWKNWWALELDSKPSSLVTYIK
QLLPFYKVLHTRNIGVDFIHPDEAMDRYKVVFAPASYRVTKAFADKVKDYVEKGGYFVSN
FFSGIADENDRVYLGGYPGAYRDILGIYVEEFAPMKKGAVHQIRTGYGDAAIRVWEEKIH
LKGAEALAWFKDGYLAGSPAVTAHHCGKGKAYYIGTQPDEQYLSSLLKDILQEADVRPAL
DAPRGVEVVVRKNGNEKYLFLLNHTDQVQFVNAGGTYLELINGDTESETVRLSPRDVKIL
QVIEK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaacaagaaaaattttattatggcggggattataaccctgaacaatgggat
gaatctgtgtggaaagaagacatgcggctgatgaaaaaagccggcgtcaattatgtaagc
atcaacattttcagctgggcaaggctgcagccggatgaagaaacatatgatttttcaacg
ctcgataaaatcatggatatgcttgcggaaaacggcatcggggcggatctggccactgcc
actgcggccccgccggcatggctgtcgcggaaatatcccgattcgcttccggttgacaag
gacggggcgcgctttctgccggggtcgcgccagcattattgcccgaacagcaaagactac
gcgcggcttgcggcgaaactggtgcgcaaaattgcggaacggtacaaaaatcatcccgcg
cttgtcatgtggcatgtgaacaatgagtatggctgccacattgccgaatgctactgcgac
aactgcaaaaaagcttttcaaacatggctcaaagaaaaatacagcacgatcgagaacttg
aataaaagctggtcaacggacttctggagccagcgttattatgaatgggaagaaatctgt
ctcccggggaaaacgccgacttttgccaatccgatgcaacagctcgattacaaagccttt
atggatgattcactgcttgcactttataaaatggaacgcgatatcctgaaagcatatacg
ccggatgtgccggtaatgacaaacttaatggggctgcacaaaccggtggacggattccat
tgggcgaaagaaatggatcttgtgacatgggatgcatatccggatcctttcgaccgtatt
ccgtatgcgcagtttatggcccatgatttaatgcggagtttgaaaaagcaaccgtttttg
ttgatggaacaggcggcgggcgcagtcaactggcgtgcgcaaaatgccgtgaaaacacca
gggcagatgcggctttggagttatgaagcggctgcgcacggggcggatggcatcatgttt
ttccaatggcgcgcatcccagggcggtgcggagaaattccatagcgggatggtaccgcat
tccggggatgaagaaagccggaatttccgggaagtggtacaactcggcaatgaattgaaa
aatttggaaaaggtaacgggttcagcatatgcagccgatgttgcgattgttttcgactgg
aaaaactggtgggcattggagctcgattcaaaaccttcttcgcttgtaacctatattaaa
cagcttctgccgttttataaggtgcttcatacccgaaacatcggtgtcgattttattcac
ccggatgaggcaatggaccggtataaagtagtttttgcgccggcaagttacagggtgaca
aaggcatttgcggataaagtaaaagactatgtcgaaaaaggcggttattttgtcagcaat
ttcttcagcggcattgcggatgaaaacgaccgtgtgtatcttggcggctatccgggcgcg
taccgggatattcttggcatttatgttgaagagtttgcgccgatgaaaaaaggggcggtg
catcaaatccggaccgggtatggcgatgcggctattcgcgtgtgggaggaaaagattcac
ttgaaaggtgccgaagctttggcctggttcaaagacggctatttggccgggtcgcctgct
gtcaccgcgcatcattgcggaaaaggaaaagcttattatattgggacacagccggatgaa
caatatttgtcttctcttttaaaagacattttacaggaagcggatgtccgaccagctttg
gatgctcctcgtggcgtggaagtggtggtgcgcaaaaatggaaatgaaaaatacttgttc
ctgcttaaccacacagatcaggttcagtttgtgaatgcaggtggcacgtacctggaactg
attaacggggatactgaatcagaaacggtccggctctcaccccgggatgtgaaaattttg
caggtaattgaaaaatag

DBGET integrated database retrieval system