KEGG   Bacillus coagulans 36D1: Bcoa_0873Help
Entry
Bcoa_0873         CDS       T01628                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bag  Bacillus coagulans 36D1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(939709..940785)
Genome map
AA seq 358 aa AA seqDB search
MKKKIGRKFIFLFLILIFMLVVAILFIRIQVNKQENGKTLPLRDLAKKNNMLLGASVSSV
PFYKDNLYRKMIKKEFNIITIENDLKFSSVHPSENQFNFNRSDKIIQFAKKNDIKVRGHT
LVWDKHLPNWVTKNNYSNEELKLILRDHIKKVVGHYRGKIYAWDVVNEAFNEDGSLKNNF
WLRHIGPEYIEFAYKWAHEADPNALLFYNDYNYAGINIKSTKIYNEVKRLKEKGVPIDGI
GFQFHKTTEDKINFRSISENIKRFSESGFRVEFTEVDVKIQNINNNTLNNKIALRKQAKI
YSNTLNVCLSNESCNAFVMWGVVDKYSWLPEDNKPLILNKNYQPKPAYFSIYKTLEKN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagaaaataggtagaaaattcattttcctatttttgattttaatctttatgctt
gttgttgctattctatttattagaatacaggttaataaacaagaaaacggtaaaacttta
cctcttcgtgacttagctaagaaaaataatatgttattgggtgcttctgttagttcagtg
cctttttataaggataatctttacagaaaaatgataaagaaggagtttaatattataact
atagaaaatgatttgaaattttccagtgtacatccgagtgaaaatcagtttaattttaac
cgttcagataaaataatacaatttgctaaaaaaaatgatataaaggtaagaggacatact
cttgtatgggataaacatttacctaattgggtcaccaaaaataattactctaatgaagaa
ttaaagttaatattaagagaccatataaaaaaagtggtaggtcattatagaggtaaaatt
tatgcttgggatgttgtaaatgaagcatttaatgaggatggttcattaaaaaataatttt
tggttaaggcatattggccctgaatatatagaatttgcatataagtgggctcatgaagcc
gatccaaatgcccttcttttttacaatgactataattatgcaggtattaatataaaatcg
acaaaaatttataatgaagtaaaaaggttaaaagaaaagggtgttccaatcgatggaatt
ggatttcaatttcataaaaccacagaagataaaatcaattttagaagtatttcagaaaac
ataaagagattttcggagtctggttttagagtggaatttactgaagttgacgtaaagata
caaaatataaataataatacacttaataataaaatagcgcttagaaaacaagcgaaaata
tattctaatacattaaatgtctgcttatcaaatgaaagttgtaatgcatttgtaatgtgg
ggggttgttgataagtattcttggttaccagaagataataaacccttaatattaaataaa
aattatcaaccaaagcctgcatatttttctatttataaaaccttggaaaaaaattaa

DBGET integrated database retrieval system