KEGG   Bacillus coagulans 36D1: Bcoa_0923Help
Entry
Bcoa_0923         CDS       T01628                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bag00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(995661..997151)
Genome map
AA seq 496 aa AA seqDB search
MEKFILSIDQGTTSSRAILFNQKGEIVHTAQQEFHQYFPQPGWVEHNANEVWASVLAVMT
TVLTEADVEPKQIAAIGITNQRETTVVWDKNTGHPIYNAIVWQSRQTADICADLKEKGYT
DMVREKTGLLIDPYFSGTKIKWILDHVDGARERAEKGELLFGTIDTWLIWKFSGGKAHVT
DYSNASRTLLYNIYDLKWDPELLEMLDVPAAMLPEVKPSSHVYAQTAPYHFFGEEIPIAG
VAGDQQAALFGQACYEDGMAKNTYGTGCFMLMNTGEKAVSSKHGLLTTLAWGIDGKVEYA
LEGSIFVAGSAIQWLRDGMRMIKDSAQSESYAERVDSTDGVYVVPAFVGLGTPYWESDVR
GAVFGLTRGTTKEHFIRATLESLAYQTKDVLAAMEADSGLPLKTLRADGGAVKNNFLMQF
QSDMLGVPVERPVVSETTALGAAYLAGLAVGYWESREEIARQWKVERKFEPSLAEKEREA
LYDGWKKAIRATIAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatttattttatccattgaccaggggacaacgagttcaagggccattcttttt
aaccaaaaaggggaaattgtgcatacagcccagcaggagtttcaccagtattttccacag
cctggctgggtggagcacaatgcaaatgaagtgtgggcatcggtgctagcggttatgacg
accgttttgacagaagcggatgtggagccgaaacagattgccgcgatcggaattaccaac
cagcgggagacaacggtcgtctgggataaaaacaccgggcatccgatttacaatgccatc
gtctggcagtcgcggcagacagcggacatttgcgccgatttaaaagaaaaaggctatact
gatatggtccgtgaaaaaaccgggctccttatcgacccgtatttcagcgggacaaaaatc
aaatggatcctcgaccatgttgacggggcaagagaacgcgctgaaaaaggcgagctcctg
tttggaacaatcgacacttggctgatctggaaattttcaggcggaaaagcccatgttacc
gactattcgaacgcgtcccggacacttttgtacaatatttacgatttgaagtgggacccc
gagctgcttgaaatgctggacgttcctgctgcgatgcttccggaagtcaaaccttcctcc
catgtttatgcacagactgcgccgtaccatttcttcggcgaggaaattccgatcgcaggc
gtggcgggcgaccagcaggcggcgctgttcgggcaggcctgctatgaagatgggatggcg
aaaaatacgtacggcaccggttgctttatgctcatgaataccggcgaaaaagccgtttct
tccaagcatggattgctgacgacgcttgcatggggcattgacggcaaagtcgagtatgcc
cttgaaggcagcatctttgtggcagggtcagcaattcaatggctgcgtgacgggatgcgc
atgatcaaagacagcgcccaaagtgaatcgtatgcagaacgggtcgattcgacagatggc
gtgtatgtcgtgccggcatttgtcgggcttgggacgccgtactgggaaagcgatgtgcgc
ggcgcggtgttcgggctgacacggggcaccacgaaagaacattttatccgggccacgctt
gaatcgctcgcctaccagacgaaagatgtgcttgccgcgatggaggcggattccggattg
ccgcttaaaacattgcgtgcggacggcggcgcagtgaaaaacaattttctcatgcagttc
caaagcgatatgttgggcgtgccggttgaacgcccggttgtgagcgaaactacagcactt
ggcgccgcatatttggcggggcttgcggtcggttactgggaatcgcgtgaagaaattgcc
cgccagtggaaagtggaacgcaaatttgaaccgtcactcgcggaaaaagagcgcgaagcc
ttatatgacggatggaaaaaagcaatccgtgcaaccattgcctttaaatag

DBGET integrated database retrieval system