KEGG   Bacillus coagulans 36D1: Bcoa_0923Help
Entry
Bcoa_0923         CDS       T01628                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bcoa_0923
Enzymes [BR:bag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Bcoa_0923
Exosome [BR:bag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcoa_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(995661..997151)
Genome map
AA seq 496 aa AA seqDB search
MEKFILSIDQGTTSSRAILFNQKGEIVHTAQQEFHQYFPQPGWVEHNANEVWASVLAVMT
TVLTEADVEPKQIAAIGITNQRETTVVWDKNTGHPIYNAIVWQSRQTADICADLKEKGYT
DMVREKTGLLIDPYFSGTKIKWILDHVDGARERAEKGELLFGTIDTWLIWKFSGGKAHVT
DYSNASRTLLYNIYDLKWDPELLEMLDVPAAMLPEVKPSSHVYAQTAPYHFFGEEIPIAG
VAGDQQAALFGQACYEDGMAKNTYGTGCFMLMNTGEKAVSSKHGLLTTLAWGIDGKVEYA
LEGSIFVAGSAIQWLRDGMRMIKDSAQSESYAERVDSTDGVYVVPAFVGLGTPYWESDVR
GAVFGLTRGTTKEHFIRATLESLAYQTKDVLAAMEADSGLPLKTLRADGGAVKNNFLMQF
QSDMLGVPVERPVVSETTALGAAYLAGLAVGYWESREEIARQWKVERKFEPSLAEKEREA
LYDGWKKAIRATIAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatttattttatccattgaccaggggacaacgagttcaagggccattcttttt
aaccaaaaaggggaaattgtgcatacagcccagcaggagtttcaccagtattttccacag
cctggctgggtggagcacaatgcaaatgaagtgtgggcatcggtgctagcggttatgacg
accgttttgacagaagcggatgtggagccgaaacagattgccgcgatcggaattaccaac
cagcgggagacaacggtcgtctgggataaaaacaccgggcatccgatttacaatgccatc
gtctggcagtcgcggcagacagcggacatttgcgccgatttaaaagaaaaaggctatact
gatatggtccgtgaaaaaaccgggctccttatcgacccgtatttcagcgggacaaaaatc
aaatggatcctcgaccatgttgacggggcaagagaacgcgctgaaaaaggcgagctcctg
tttggaacaatcgacacttggctgatctggaaattttcaggcggaaaagcccatgttacc
gactattcgaacgcgtcccggacacttttgtacaatatttacgatttgaagtgggacccc
gagctgcttgaaatgctggacgttcctgctgcgatgcttccggaagtcaaaccttcctcc
catgtttatgcacagactgcgccgtaccatttcttcggcgaggaaattccgatcgcaggc
gtggcgggcgaccagcaggcggcgctgttcgggcaggcctgctatgaagatgggatggcg
aaaaatacgtacggcaccggttgctttatgctcatgaataccggcgaaaaagccgtttct
tccaagcatggattgctgacgacgcttgcatggggcattgacggcaaagtcgagtatgcc
cttgaaggcagcatctttgtggcagggtcagcaattcaatggctgcgtgacgggatgcgc
atgatcaaagacagcgcccaaagtgaatcgtatgcagaacgggtcgattcgacagatggc
gtgtatgtcgtgccggcatttgtcgggcttgggacgccgtactgggaaagcgatgtgcgc
ggcgcggtgttcgggctgacacggggcaccacgaaagaacattttatccgggccacgctt
gaatcgctcgcctaccagacgaaagatgtgcttgccgcgatggaggcggattccggattg
ccgcttaaaacattgcgtgcggacggcggcgcagtgaaaaacaattttctcatgcagttc
caaagcgatatgttgggcgtgccggttgaacgcccggttgtgagcgaaactacagcactt
ggcgccgcatatttggcggggcttgcggtcggttactgggaatcgcgtgaagaaattgcc
cgccagtggaaagtggaacgcaaatttgaaccgtcactcgcggaaaaagagcgcgaagcc
ttatatgacggatggaaaaaagcaatccgtgcaaccattgcctttaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system