KEGG   Bacillus coagulans 36D1: Bcoa_1204Help
Entry
Bcoa_1204         CDS       T01628                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bag  Bacillus coagulans 36D1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcoa_1204
DNA repair and recombination proteins [BR:bag03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bcoa_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1295535..1296131)
Genome map
AA seq 198 aa AA seqDB search
MQYPEPITKLMESFMKLPGIGPKTAARLAFFVLDMKEDSVLAFAKALVDAKRDLTYCSVC
GHITDTDPCYICADPRRDRSVICVVEEPKDVIAMEKMKEYNGLYHVLHGAISPMDGIGPE
DISVPDLLKRLRDETVQEVILATNPNIEGEATAMYISRLLKPSGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccctgaaccaatcacaaaattaatggaaagcttcatgaaactgccaggcatt
gggccgaaaaccgcggcccggctggcattttttgttcttgatatgaaggaagacagcgtc
cttgcatttgccaaggcgcttgtcgatgcgaaacgggacctgacgtactgttctgtttgc
gggcatatcaccgatacagatccgtgctatatttgtgccgatccgcgccgcgacagaagc
gtgatctgcgttgtcgaggagccgaaagacgtcattgccatggaaaaaatgaaagaatac
aacggcctttaccatgttctgcatggtgccatttctccaatggacggaatcggccctgaa
gacatcagtgtgccggatctgctcaaacgcctgcgcgatgaaaccgtccaagaagtgatt
cttgcaaccaatccaaatatcgaaggcgaagcaacagccatgtatatttcgcggctttta
aaaccgtccggcattaaagtgacacggattgcacacgggttgccagtgggcggagatctc
gagtacgccgacgaagtcaccttatcaaaagcactggaaggccgaagagaaatttaa

DBGET integrated database retrieval system