KEGG   Bacillus coagulans 36D1: Bcoa_1204Help
Entry
Bcoa_1204         CDS       T01628                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bag  Bacillus coagulans 36D1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bag03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1295535..1296131)
Genome map
AA seq 198 aa AA seqDB search
MQYPEPITKLMESFMKLPGIGPKTAARLAFFVLDMKEDSVLAFAKALVDAKRDLTYCSVC
GHITDTDPCYICADPRRDRSVICVVEEPKDVIAMEKMKEYNGLYHVLHGAISPMDGIGPE
DISVPDLLKRLRDETVQEVILATNPNIEGEATAMYISRLLKPSGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccctgaaccaatcacaaaattaatggaaagcttcatgaaactgccaggcatt
gggccgaaaaccgcggcccggctggcattttttgttcttgatatgaaggaagacagcgtc
cttgcatttgccaaggcgcttgtcgatgcgaaacgggacctgacgtactgttctgtttgc
gggcatatcaccgatacagatccgtgctatatttgtgccgatccgcgccgcgacagaagc
gtgatctgcgttgtcgaggagccgaaagacgtcattgccatggaaaaaatgaaagaatac
aacggcctttaccatgttctgcatggtgccatttctccaatggacggaatcggccctgaa
gacatcagtgtgccggatctgctcaaacgcctgcgcgatgaaaccgtccaagaagtgatt
cttgcaaccaatccaaatatcgaaggcgaagcaacagccatgtatatttcgcggctttta
aaaccgtccggcattaaagtgacacggattgcacacgggttgccagtgggcggagatctc
gagtacgccgacgaagtcaccttatcaaaagcactggaaggccgaagagaaatttaa

DBGET integrated database retrieval system