KEGG   Bacillus coagulans 36D1: Bcoa_1210Help
Entry
Bcoa_1210         CDS       T01628                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bag  Bacillus coagulans 36D1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bag00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bag00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1302770..1303438
Genome map
AA seq 222 aa AA seqDB search
MELREKYQIPNHAVITIAGTVGVGKSTLTRALAKALHFRASFEKVDTNPYLEKFYSDFKR
WSFHLQIYFLAERFKEQKKMFEYGGGFIQDRSIYEDTGIFAQMHYEKGNMSAVDFETYTN
LFDAMVMTPYFPHPDLMIYLEGKLENILERIKKRGRSMEQDTPVEYWIEMQRRYEQWIDS
FHACPVLRLNIDEYDLFEHEDAVEPIVERIGYMLAQAAAVKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaacttcgtgagaaatatcaaattccgaaccacgctgtgatcaccattgcaggtacc
gtcggcgtcggaaaatcgactttaacccgtgcgctcgcgaaggcgctccattttcgggcg
tcctttgaaaaagtcgacaccaatccgtatttggaaaaattttatagcgattttaaacgg
tggagtttccatcttcaaatttattttctggcggaaaggttcaaggagcaaaaaaaaatg
tttgaatacggcggcgggtttatccaggaccgttccatttacgaggataccggcattttt
gcccagatgcattacgaaaaaggcaatatgtctgccgttgattttgaaacctatacaaac
ttgttcgatgccatggtgatgacgccgtattttccgcatcccgacctgatgatttatttg
gaaggtaaactggaaaacattttggaacggatcaaaaaacgcggccggtcgatggaacaa
gatacccctgttgaatactggattgaaatgcagagacggtacgagcagtggatcgactct
ttccatgcctgcccggttctcaggctgaacattgacgaatacgacctgtttgaacatgaa
gatgccgtcgaaccgattgtcgagcggatcggctacatgctcgcacaggcagcagccgta
aaaaaataa

DBGET integrated database retrieval system