KEGG   Bacillus coagulans 36D1: Bcoa_1210Help
Entry
Bcoa_1210         CDS       T01628                                 

Definition
(GenBank) deoxynucleoside kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00230  Purine metabolism
bag00240  Pyrimidine metabolism
bag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bcoa_1210
   00240 Pyrimidine metabolism
    Bcoa_1210
Enzymes [BR:bag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     Bcoa_1210
    2.7.1.76  2'-deoxyadenosine kinase
     Bcoa_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin TsaE SKI AAA_28 AAA_22 Cytidylate_kin2 ABC_tran MMR_HSR1 AAA_15 RsgA_GTPase AAA_16 AAA_29 Cytidylate_kin AAA RNA_helicase NB-ARC IstB_IS21 AAA_25 AAA_5 ParA GTP_EFTU PRK AAA_14 CbiA ArgK AAA_2
Motif
Other DBs
NCBI-ProteinID: AEP00422
UniProt: G2THK5
Position
1302770..1303438
Genome map
AA seq 222 aa AA seqDB search
MELREKYQIPNHAVITIAGTVGVGKSTLTRALAKALHFRASFEKVDTNPYLEKFYSDFKR
WSFHLQIYFLAERFKEQKKMFEYGGGFIQDRSIYEDTGIFAQMHYEKGNMSAVDFETYTN
LFDAMVMTPYFPHPDLMIYLEGKLENILERIKKRGRSMEQDTPVEYWIEMQRRYEQWIDS
FHACPVLRLNIDEYDLFEHEDAVEPIVERIGYMLAQAAAVKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaacttcgtgagaaatatcaaattccgaaccacgctgtgatcaccattgcaggtacc
gtcggcgtcggaaaatcgactttaacccgtgcgctcgcgaaggcgctccattttcgggcg
tcctttgaaaaagtcgacaccaatccgtatttggaaaaattttatagcgattttaaacgg
tggagtttccatcttcaaatttattttctggcggaaaggttcaaggagcaaaaaaaaatg
tttgaatacggcggcgggtttatccaggaccgttccatttacgaggataccggcattttt
gcccagatgcattacgaaaaaggcaatatgtctgccgttgattttgaaacctatacaaac
ttgttcgatgccatggtgatgacgccgtattttccgcatcccgacctgatgatttatttg
gaaggtaaactggaaaacattttggaacggatcaaaaaacgcggccggtcgatggaacaa
gatacccctgttgaatactggattgaaatgcagagacggtacgagcagtggatcgactct
ttccatgcctgcccggttctcaggctgaacattgacgaatacgacctgtttgaacatgaa
gatgccgtcgaaccgattgtcgagcggatcggctacatgctcgcacaggcagcagccgta
aaaaaataa

DBGET integrated database retrieval system