KEGG   Bacillus coagulans 36D1: Bcoa_1374Help
Entry
Bcoa_1374         CDS       T01628                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bag  Bacillus coagulans 36D1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcoa_1374
Enzymes [BR:bag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Bcoa_1374
Peptidases [BR:bag01002]
 Cysteine Peptidases
  Family C44
   Bcoa_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1491692..1493539
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDFQKDLRSELETVKKMTETLTKRGPDDTNYWLSPHAAFGHKRLVVVDPLCGV
QPMTRQKDGKMYTICYNGELYNTEDLRAELLKKGYTYQGHSDTEVLLTAYIEWKEACVDR
LNGIFAFVVWDGNKEQVFAARDRLGVKPFFYKAHGSGLLFGSEVKAMLAHPDVKAEVDEA
GLAEIWGLGPSRTPGTGIFRGMAELRPAHALKMDRNGLKVWRYWNVKSAPHTEAAEETAE
TIRLLIQDAIVRQLVSDVPVCTFLSGGVDSSAITAIAAGHFQREGKGRLHTFSIDYEGND
RYFKANDFQPDADGVFIRKMSEAFDTVHHHCVITQEELAESLKAAVLARDVPGMADVDSS
LLWFCREIKKDFTVSLSGECADEIFGGYPWFRREDDLNREGFPWMRSLDERIGLLKEGWQ
EKLQLKDYVMSKYEASVAETPLLDGETDLEKKRRQLFYINMLWFMTTLLDRKDRMSMGAS
LEVRVPFADHRIVEYVWNIPWEMKMYGGREKGILRKALEGILPEEILYRKKSPYPKTHHP
AYTAAVKRWLGEVLEQKDSILYEFLHRDQLMELMETDGKAFRTPWFGQLMTGPQLLAYLA
QIHYWFETYRIDIKA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaataaccggatgggtcgattttcaaaaagacttgcggagtgaactggaaaca
gtcaaaaaaatgacagagacgttgaccaaacggggaccggatgatacgaattactggctt
tcgccacatgcggcattcggccataaacggctcgtcgttgttgaccctttatgcggtgtg
cagccgatgacgcggcaaaaggacggaaagatgtatacaatttgctataacggcgaattg
tacaatacggaagatttgcgcgcggagcttttgaaaaaaggctatacttatcagggccac
tcggatacggaagtgcttttaaccgcttatatcgagtggaaagaggcatgtgtggaccgc
ctgaacggcatttttgcgtttgtggtctgggacgggaacaaggaacaggtatttgcggca
cgcgaccgcctcggggtaaaaccgtttttttacaaagcacacggaagcgggcttttgttc
ggctcggaagtaaaagcgatgctcgcccacccggatgtgaaagcggaagtggatgaggca
gggcttgccgaaatatgggggctcgggccgtcgagaacaccggggacgggaatatttcgc
ggcatggcggaactgcgcccggcacatgcgctgaagatggatcgtaacggattaaaagtg
tggcggtactggaacgtgaaaagcgcgccgcatacggaggcagcagaggaaacggcggaa
acgatccgtttgctcattcaggatgcgattgtccgtcagcttgtctcggatgtcccggtt
tgcacgtttttatccggcggcgtcgattcaagcgccattaccgccattgctgcaggccat
tttcaaagggaaggaaaagggcggctgcatactttttccattgattacgaagggaacgac
cgctatttcaaagcgaatgattttcagccggatgctgacggggtatttatccgcaagatg
tcagaagcatttgatacagtccaccatcattgcgtgatcacgcaggaagaactggccgaa
tctttaaaagcggctgttctcgcccgggatgtgccgggaatggcggatgttgactcatcg
ctgctctggttttgccgcgagatcaaaaaggattttaccgtcagcctttcgggtgagtgc
gcggatgaaattttcggcgggtatccgtggttccggcgcgaagatgatttgaaccgagaa
ggcttcccatggatgcggtccctcgatgaacggatcggcctgttaaaagaaggctggcag
gaaaaattgcagttaaaagattacgtgatgtcgaaatatgaagcgtctgttgcggaaacg
ccgcttttagatggcgaaaccgatttggaaaaaaagcgtcgccagctgttttacatcaat
atgctttggtttatgacaacgctccttgaccggaaagaccggatgagcatgggggcgagc
ctcgaggtgcgcgtaccgtttgccgatcaccggattgtggagtacgtctggaatataccg
tgggagatgaagatgtacggcggcagggaaaagggcattttgcggaaagcgctggaaggc
attttgccggaagagattttataccggaaaaaaagcccgtatccgaagacgcaccatccg
gcttacacggcagcagtgaagcggtggctcggtgaagttttggaacagaaagattccatt
ttgtatgaatttttgcatcgcgatcaattaatggagttgatggagacagacgggaaagca
ttccggacaccgtggttcggacagctgatgacgggcccgcagctgcttgcctacctcgcc
cagatccattactggtttgaaacatacaggattgacattaaagcttag

DBGET integrated database retrieval system