KEGG   Bacillus coagulans 36D1: Bcoa_1436Help
Entry
Bcoa_1436         CDS       T01628                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bag  Bacillus coagulans 36D1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcoa_1436
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bcoa_1436
Enzymes [BR:bag01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Bcoa_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1558620..1559906
Genome map
AA seq 428 aa AA seqDB search
MEKLKIAGGYPLKGTIKVSGAKNSAVALIPATILAESPVTIEGLPEISDVRTLTGLLEEI
GATVTSEDGEITVDPRHMISMPLPNGRVKKLRASYYLMGAMLGRFKKAVIGLPGGCHLGP
RPIDQHIKGFEALGAKVTNEQGAIYLRADELKGARIYLDVVSVGATINIMLAAVKAKGRT
IIENAAKEPEIIDVATLLTNMGAKIKGAGTDVIRIEGVDHLSGCRHTIIPDRIEAGTFMI
LAAAAGEGVLVDNVIPHHLESLTAKLREMGIPVETGDEQIFIGKADKLKPVDIKTLVYPG
FPTDLQQPFTTLLTRAEGTSIVTDTIYSARFKHIDELRRMSANIKVEGRSAIVNGPVRLQ
GAKVKASDLRAGAALVIAGLMAEGVTEVTGVEHIDRGYSCLVEKLTGLGAAVWREGMSEK
EMEHLNHS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagctaaaaattgccgggggatatcctttgaaaggcaccattaaagtgagcggc
gcaaaaaacagcgctgtcgctttaatacctgctaccatcctcgcggaatctcctgtaaca
atagaaggcttgcctgaaatttccgatgtccggacattgaccggcctgctggaagagatc
ggggcaacggttacgtcagaggacggggaaattacggtcgatccccgccatatgatctcg
atgccgctgcccaatggcagggtgaagaaactgcgtgcctcatactatttaatgggcgcg
atgctcggcaggttcaaaaaagctgtcatcgggctgccgggcgggtgccatctcggaccg
cggccgatcgaccagcatattaaaggttttgaagcattgggcgcaaaagtgacaaatgag
cagggtgccatctatttaagggcggatgaattgaaaggtgcccgtatttatctggacgtt
gtcagtgtcggggcaacgatcaatattatgctggctgccgttaaagcaaagggaaggaca
atcattgaaaacgctgcaaaagagccggaaatcattgacgtagccacacttttgacaaat
atgggcgcaaaaattaaaggcgccggaacagatgtcatccggattgaaggcgtagatcat
ttgagcggctgccggcatacgattattccggacaggatcgaagccggtacgtttatgatc
ctggcggcggccgcgggtgaaggagtacttgttgacaatgtcattccgcatcatctcgag
tcgctgaccgcaaagctcagggaaatgggcatacctgtggaaaccggggatgaacagatt
tttatcgggaaagcagacaagctgaaacccgttgatattaaaacgctcgtttatccgggg
tttccgacagatctgcaacaaccgttcaccacgcttctgacaagagcagaagggacgtcc
atcgtaaccgatacaatctattccgcccgctttaaacatattgacgagttgcggagaatg
agcgccaatattaaagtggaaggacggtctgcgattgtaaacggtccggtccggcttcaa
ggggcaaaggtgaaagcgagtgatttgcgtgcgggtgctgcccttgtcattgccggcctg
atggcagaaggcgtgacagaagtgacaggcgttgaacatatcgaccgcggatacagctgc
ctcgtggaaaaactaaccggacttggtgctgctgtttggcgggaaggcatgtccgaaaag
gagatggaacacctgaaccattcctag

DBGET integrated database retrieval system