KEGG   Bacillus coagulans 36D1: Bcoa_1465Help
Entry
Bcoa_1465         CDS       T01628                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bag  Bacillus coagulans 36D1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bag00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bag00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1583444..1584757
Genome map
AA seq 437 aa AA seqDB search
MEKIIVRGGNRLQGAVQVEGAKNAVLPVIAASLLASEGKSIIRDVPQLSDVFTISEVLRH
LNAEVTFLENEITVDASRELSIETPFEYVRKMRASFLVLGPLLARTGKARVALPGGCAIG
SRPIDLHLKGFEAMGAKVDVGNGFIEASVSGRLHGAKIYMDFPSVGATQNIMMAASLADG
QTVIENCAKEPEIVDLANFLNEMGANVKGAGTGTIKIEGVEKLHAADHTIIPDRIEAGTF
MVAAAITKGNVLVKGAVPEHISSLIAKLEEMGVTIIEEENGVRVIGPETLKAVDIKTMPY
PGFPTDMQSQMMALLLCAEGTSVITETVFENRFMHVEEFRRMNADLKIEGRSVIVNGPCN
LQGAEVAATDLRAAAALIIAGLAAKGITRVTELKHLDRGYLNFHLKLAALGANIERVDDE
AEVAPAKQDQLLADANL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagatcatcgtccgcggcggaaacaggcttcagggcgccgttcaagtggaaggc
gcaaagaatgccgtattgcctgtgatcgctgcatcgttattggcaagtgaaggaaaaagc
atcatacgtgatgtaccacaactctccgatgtatttacaatcagtgaagtgctgcgccac
ctgaatgctgaagttacgtttctggagaatgaaatcactgtagatgcatcaagggagtta
tcaattgaaacgccttttgaatatgtacgcaaaatgagggcatcttttttagtgctgggg
ccgttactggcaagaaccgggaaagcaagggtcgcattaccgggaggctgcgccatcgga
tcccgccctattgacttgcacttaaaaggatttgaagcaatgggcgccaaagtagatgtg
ggaaacggctttattgaagcgtcggtatccggccgcttgcatggcgcgaaaatatatatg
gattttccaagcgtcggcgcaacccagaatattatgatggccgcatcgctggctgacgga
caaacggtcattgaaaactgtgcaaaagaacctgaaattgtggatcttgccaatttcctg
aatgaaatgggcgcgaatgtaaaaggtgccggcacgggaaccatcaagatcgaaggtgtg
gagaagctgcatgctgctgatcataccatcataccggacagaattgaagcagggacattt
atggttgctgctgcgattacaaagggaaatgtgttggtaaaaggtgcggtacctgagcat
atttcttccttaattgcaaaactggaggaaatgggtgtaaccatcattgaagaagagaac
ggcgtccgggttatcggcccggaaacattaaaggcagtagacatcaagacaatgccttat
ccgggatttccgaccgatatgcagtcgcaaatgatggcgctccttttgtgtgctgaaggc
acgagcgtgattacggaaacggtatttgaaaaccgattcatgcatgtggaagaattccgg
cgcatgaatgcggatttaaaaatagaagggcgttcggttattgtgaacgggccgtgcaat
ttgcagggggctgaagttgccgcaacagacctgcgggcagccgccgctttaattattgcc
gggctggcggcaaaaggcatcacccgggtgaccgaattaaaacatctggatcgcggctat
ttgaactttcatttaaaactggctgcacttggggccaacattgaaagggtcgacgatgaa
gcggaagttgcgccggcaaaacaagatcagttgcttgctgacgccaatctctag

DBGET integrated database retrieval system