KEGG   Bacillus coagulans 36D1: Bcoa_1628Help
Entry
Bcoa_1628         CDS       T01628                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bag  Bacillus coagulans 36D1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcoa_1628
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcoa_1628
   00630 Glyoxylate and dicarboxylate metabolism
    Bcoa_1628
Enzymes [BR:bag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcoa_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1761914..1763509
Genome map
AA seq 531 aa AA seqDB search
METKAPGITVTGSIHDGYDDILTPEALQFLEQLERHFGERRRELLAYRKKRDEEIKSGKL
PHFLEETASIRESDWTIAPLPEDLQDRRVEITGPVDRKMVINALNSGAKIFMACFEDATS
PTWENIIEGQIHLRDAVNRTITFTGPNGKEYKLADHPAVLIVRPRGWHLEEKHILVDGKP
ISGSLTDFGLYFFHNARRLLENSTGPYFYLPKMESHLEARLWNDVFIFAQKYIGIPKGTI
KATVLIETIMAAFEMDEILYELKEHSAGLNCGRWDYIFSYIKKLRTNPQFITPDRSLVTM
TVPFMRAYSLLTIKTCHRRNAPAIGGMAAQIPVKDDPAKNEEAFQKVRADKEREARDGHD
GTWVAHPGLVPVALEAFNKEMPEPNQIHSGKQMDFTATADDLLAVPQGEITEKGIRENIY
AGIQYIESWLRGRGAVPISNLMEDAATAEISRTQLWHWIRHPKGVLQDGRKVTIELYEQI
KAEELERIRREIGEEYYRAGRFEEAVALFDRLVKEDEFIEFLTLPAYELLG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaaagcaccaggcattaccgtaacgggatccatccatgacgggtatgacgac
atattgaccccggaagcgctgcaatttttggaacagctggagcggcatttcggcgaaagg
cggcgtgaactgctggcctacagaaaaaagcgcgatgaagaaatcaaatcgggcaagctt
ccacattttctcgaagaaacggcctccatccgcgaatccgactggaccattgccccgctt
cccgaagatttgcaggacaggcgtgtggagattaccgggccggttgaccggaaaatggtg
atcaatgctttgaattcaggcgcaaaaatatttatggcctgctttgaagatgctacttcc
ccgacatgggagaatatcattgaaggccagatccatctccgtgatgcggtcaaccggacg
attacttttaccgggccgaatggaaaagaatacaaactggccgatcatcccgctgtctta
atcgtcagaccgcgcggatggcatttggaagagaaacatattttagtagacggtaaacct
atatccggcagtttaacagatttcgggctttacttcttccataatgcccgcaggctcctt
gaaaacagcacaggcccgtacttttacctgccaaaaatggaaagccatctggaagcgcgc
ctttggaatgatgtttttatctttgctcaaaagtatatcggcatcccgaaaggcaccatt
aaagcgactgtcctgattgaaacgattatggctgcatttgaaatggacgaaatcctttac
gaactgaaagagcattcggcaggcctcaactgcgggcgctgggactatattttcagctat
attaaaaaactgcgtaccaatccgcagtttattacgccagacaggtctcttgtcaccatg
acggtcccgtttatgcgcgcttattcgcttttgaccattaagacgtgccaccgccggaat
gcgccggcaatcgggggaatggccgcgcagatcccggtaaaagacgacccggcaaaaaat
gaagaagccttccaaaaggtgcgtgccgataaagagcgggaagcaagagacgggcatgac
ggcacctgggttgcgcatcctgggcttgtgccagtcgccttggaagcatttaataaagaa
atgcctgagccgaaccaaatccactccggcaagcagatggattttacggcgacggcagat
gatctgcttgctgtgccgcaaggggaaatcacggaaaaaggaatccgtgaaaacatttat
gccggcatccagtacatcgaatcctggctcaggggaaggggtgctgtgccgatctcgaac
ttaatggaagatgcggcgacggctgaaatttctcgcacccagctttggcactggattcgc
catccgaagggcgtgcttcaagacggcagaaaagtgacgattgagctatatgaacaaatc
aaagcggaagaactggaacgcatccgccgggaaatcggggaggaatattaccgggccggc
cgttttgaagaagcagtagccttatttgaccggcttgttaaagaagacgaatttattgaa
tttttaaccttaccggcgtatgaattgctgggctga

DBGET integrated database retrieval system