KEGG   Bacillus coagulans 36D1: Bcoa_1629Help
Entry
Bcoa_1629         CDS       T01628                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcoa_1629
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bcoa_1629
Enzymes [BR:bag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bcoa_1629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1763723..1765000
Genome map
AA seq 425 aa AA seqDB search
MVNEKALELKRSWEKDERWQGIVRPYAPEDVLKLRGSVQIEYTLARRGAEKFWNLLHTED
YIHALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPANSVPNVVKRI
NQALQRADQIHHAEGDERIDWFAPIVADAEAGFGGPLNVFELTKAMIEAGAASVHLEDQL
SSEKKCGHLGGKVLQPTQTAIRHLIAARLAADVMGVPTVIIARTDANAANLITSNVDPYD
APFITGERTAEGFYRTKAGIDQAIARGLAYAPYADMIWCETSEPNLDEARRFAEAIHEKF
PGKLLAYNCSPSFNWKKKLDDKTIANFQKEIARMGYKFQFVTLAGFHALNHSMFELARNY
RDRGMAAYSELQQAEFANEQYGYTATRHQREVGTGYFDEVSMVISGGTSSTTALTGSTEQ
EQFIH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacgaaaaagcgcttgaattgaaacgaagctgggagaaagatgaaaggtggcag
gggattgtccgcccgtatgctccggaagacgtgctcaaactgaggggttctgttcaaatt
gaatatactttggcgcgcaggggggcggaaaaattctggaatctgctgcatacggaagat
tatatccatgcattgggtgcactcacgggaaatcaggccgtccagcaggtaaaggccgga
ttgaaagccatttatttaagcggctggcaggttgcagctgatgcgaaccttgccgggcaa
atgtatccggaccaaagcctgtatccggcgaacagcgtgccgaatgtcgtcaaacggatc
aaccaggccctgcagcgtgccgaccagatccaccatgcagaaggggacgaacggattgat
tggtttgcgccgatcgttgccgatgcagaagccggttttggcggcccgttaaacgtattc
gaactgacaaaagcgatgatcgaagcgggtgccgcgtctgtccatcttgaagaccagctt
tcatccgagaagaaatgcggccatttgggcggcaaagtgttgcagccgacacaaacagct
atccgccacttgattgcagcccgccttgctgctgatgtcatgggcgtgccgaccgttatc
attgcccgtacggatgcaaatgcggcaaatctgatcacaagcaatgttgacccatatgat
gcgccgtttatcaccggggaacggacagcggaaggtttttaccgcacaaaagcaggcata
gaccaggcgattgcccgcggccttgcttacgcgccatatgccgatatgatctggtgcgaa
acgagtgagccgaatctggacgaagcacgccggtttgcagaagcgatccatgaaaaattc
ccgggtaaacttttggcttacaactgctcgccgtcgttcaactggaagaagaaactcgat
gacaaaacaattgcgaacttccagaaagaaattgcgcgcatgggctataaattccagttc
gttacgcttgccggcttccatgccttgaaccacagcatgtttgaactggcccgcaactac
cgcgaccgcggcatggcagcctattccgaactgcagcaggccgaatttgcaaacgaacaa
tatggttacacggcaacacgccatcagcgcgaagtcgggaccggttatttcgatgaagtc
tcgatggtcatctcaggcggcacttcttccaccaccgcactcacaggatcgaccgagcag
gaacaattcattcattaa

DBGET integrated database retrieval system