KEGG   Bacillus coagulans 36D1: Bcoa_1666Help
Entry
Bcoa_1666         CDS       T01628                                 

Definition
molecular chaperone GroES
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcoa_1666
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcoa_1666
  Lipid metabolism
   00071 Fatty acid degradation
    Bcoa_1666
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcoa_1666
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcoa_1666
   00626 Naphthalene degradation
    Bcoa_1666
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcoa_1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1800991..1802013
Genome map
AA seq 340 aa AA seqDB search
MRAAVVSSDKQKLVEVKDVQLRPLEYGEALVDIEYCGVCHTDLHVAKGDFGDVPGRILGH
EGVGIVREVADGVTSLKVGDRVSVAWFFEGCGHCEYCLTGNETFCRDVKNAGYSIDGAMA
EQCIVKADYAVKVPEGLDPRQATSITCAGVTTYKAIKVADVKPGEWIAIYGAGGLGNLAV
QYAKHVFNAKVIAIDINDDKLSLAKEVGADLTFNSKMKGDPAEWIQKEVGGAHAAVVTAV
SKQAFNQAVHSVRPVSKVVAVGLPPETMDLEIVKTVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTRRLEEVGDVFKEMEEGRIQGRMVLDMSLK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagtcgtcagttctgataagcaaaaactggtagaggtcaaagatgtgcag
ttgcgtccacttgaatatggggaagctttggtggatatcgaatactgcggtgtctgccat
acggatctgcatgtggcaaagggcgactttggcgatgtgccgggacgcattctcggccat
gaaggagtcggcattgtcagggaagtcgcggatggtgtcacttctcttaaagtgggcgat
cgtgtaagcgttgcctggttttttgaaggctgcgggcattgtgagtactgtttaacggga
aatgaaacattttgccgtgatgtgaaaaatgcaggctacagtatcgacggagcaatggca
gagcagtgcatcgtcaaagcggattacgccgtaaaagtgccggaagggctggatccaagg
caggcgacgagcattacttgcgcaggtgtcaccacttataaagccattaaagtcgcagat
gtgaagccgggcgaatggattgccatttatggagccggcggtcttggtaaccttgctgtc
cagtacgccaaacatgtatttaatgcgaaagtcattgcgatcgatatcaatgacgacaaa
ctttcactggcaaaagaagtcggtgctgatctcacctttaattccaaaatgaaaggcgat
ccggctgaatggatccaaaaagaagttggcggcgcgcatgctgcagtggtaacggctgtt
tcaaaacaggcttttaaccaggctgtccactctgtacggccggtttcaaaagtcgttgct
gtcgggctccctccggaaacaatggatcttgaaattgtgaagacggttcttgacggaata
gaagtcgtcggctctttggtaggcacgagaaaagaccttgaggaagcttttatgttcggt
gcggaaggaaaagtcgtcccggttgtgcaaacgcgcagactggaagaagttggagatgtt
tttaaggaaatggaagaaggcagaatacaaggcaggatggttctggatatgtcgttgaaa
taa

DBGET integrated database retrieval system