KEGG   Bacillus coagulans 36D1: Bcoa_1754Help
Entry
Bcoa_1754         CDS       T01628                                 

Definition
(GenBank) PfkB domain protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcoa_1754
Enzymes [BR:bag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcoa_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin CoA_binding_2 Cellulase
Motif
Other DBs
NCBI-ProteinID: AEP00949
UniProt: G2TI16
Position
1902455..1903378
Genome map
AA seq 307 aa AA seqDB search
MEFDVVVVGSINMDVVVNCETYPKYGNTEFCQSIKMLPGGKGANQAASAATLGKKVAMVG
SVGNDSAGNQMLENLRSRGVDVTGVMKTDKAGTGTFIALVDQSGENTMVGTIGANEALTG
QDIEKAFANLKAKILLIQMETSKESILAAMKLAKQRGMYVILDPAPAGGITPEAFRYADL
VLPNSQETEAITGIKVTDKESALLAAQKIHELGVPNAIVKMGSKGSLVSQQGKITFVDSI
QVQAVDTVGAGDCYAGAIADALIDTDDLVAAARFASVAAGIKVSRAGGQDAIPTLEEIKK
YQGLTIG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgatgttgtggtggtaggaagcattaacatggacgttgtggtaaactgtgaa
acttatccgaaatacgggaatacggaattttgccaatcgattaaaatgctgccggggggc
aaaggtgccaaccaggcagccagcgcagcaacacttggcaaaaaggttgcaatggttggt
tcggtcggcaatgacagcgcaggcaaccagatgcttgaaaatttgcgcagccggggtgtg
gatgtcaccggcgttatgaagacagataaagccggaaccgggacgtttattgcacttgtg
gaccagtcaggggaaaacacgatggttggcacaatcggcgccaatgaagcattaaccggg
caagatattgaaaaagctttcgcgaatttgaaagcgaaaattttattgatacaaatggaa
acaagcaaagagtcgattttagcagccatgaagctggcaaaacaacgcggcatgtatgtt
attctcgatccggcaccggctggcggcattacaccggaggctttccgatatgctgatctt
gtactgccaaacagccaggaaacggaagcgatcacgggtattaaagtgacggataaagaa
agtgcgctgcttgcggctcaaaagattcatgaactcggagtcccgaatgccattgttaaa
atgggaagcaaaggcagccttgtttctcagcagggtaaaatcacttttgtcgattctatt
caagtgcaggctgttgatacggttggggcaggcgactgctatgccggtgccattgccgat
gcgctaatcgatacggacgatcttgtggcggcggcccggtttgcatcggttgcggccggt
atcaaagtctcacgtgccggcggacaagacgcgattccaacattggaagaaataaaaaaa
tatcaaggcttgacaatcggttga

DBGET integrated database retrieval system