KEGG   Bacillus coagulans 36D1: Bcoa_1766Help
Entry
Bcoa_1766         CDS       T01628                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bag  Bacillus coagulans 36D1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcoa_1766
Enzymes [BR:bag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcoa_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1913506..1914387
Genome map
AA seq 293 aa AA seqDB search
MVQITVVGSISMDLVVTADRRPQAGETILGHSFKTVPGGKGANQAVAAARLGAKVNMVGC
VGDDVYGPALIENLRQNHVSTQYVEPVTHCSSGTAHITLAEGDNSIIFIKGANDFVTPDY
VEKAKEAFEGSSIVLIQQEIPYETVEYVAKLCEKKQIPLLLNPAPARKISPAILEKTAYL
TPNEHECNFLFNGIDRSEALKRHPNQLIITEGKNGARFYDGREEIVVPSFPVETVDTTGA
GDTFNAAFAVAVAEGKEIKEALLFANRAASLSVTKFGAQGGMPTREEVDGRKR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaattacagtggtcggaagcatctcaatggatctcgtcgtgacagctgacaga
aggccacaggcaggagaaaccattttagggcactcatttaagacggtgccgggcggaaag
ggagcaaatcaggccgttgctgcggcaaggcttggggcaaaggtaaacatggttggctgt
gttggggatgatgtgtatggtccggccttaattgaaaatttgcgtcaaaatcatgtctct
acacaatatgtggaaccggttacacattgcagttccggtaccgcgcatattacgttggcg
gaaggggacaacagtattatttttatcaagggagcaaacgattttgttacaccggattat
gtggaaaaggcaaaagaagcatttgaaggctcttctattgtcttaatccagcaagaaatt
ccatatgaaacggttgaatatgtcgcgaaactttgtgaaaaaaaacagattccgctcttg
ttaaaccctgcaccggcacgaaaaatttccccagccattcttgaaaaaacagcatacttg
acgccaaatgagcatgagtgcaatttccttttcaacgggatagacaggtccgaagcatta
aaacggcatccaaaccagttaatcattacagaagggaaaaacggggcaagattttatgac
ggaagagaagagattgtcgtgccaagttttccagttgaaacagtggataccactggagcc
ggtgatacttttaatgccgcatttgcagtagccgttgcagaagggaaagaaataaaagaa
gcgctcctgtttgcaaaccgtgctgcctcgttgtcggtgacaaaattcggggcacaaggc
ggcatgcccacccgcgaagaagtagacgggaggaaaagatga

DBGET integrated database retrieval system