KEGG   Bacillus coagulans 36D1: Bcoa_1810Help
Entry
Bcoa_1810         CDS       T01628                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bcoa_1810
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcoa_1810
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bcoa_1810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1963421..1963894)
Genome map
AA seq 157 aa AA seqDB search
MSIYDYSFERLTGEEKESLAKYKNQVLLIVNTASKCGFTPQYEGLEHLYEKYKDKGFAVL
GFPSDSFMKQEFDESEKIAAFCQANYGVTFPLFKKSKMKGKEMNPLFAELLEQTGEKKIT
WNFNKFLVDRHGHAIGYYGSRTKPEDLEEKIEELLQV
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttacgactattcttttgaacggcttactggagaagagaaagagtctttggcc
aaatataaaaaccaggtgctgcttattgtcaatacggcaagcaaatgcggatttacaccc
cagtatgaggggcttgagcacctttacgaaaagtacaaagacaaggggtttgccgtgctt
ggctttccgagcgacagtttcatgaaacaggagtttgacgaaagcgaaaaaattgcagca
ttttgccaagccaactatggcgtaacattcccgttgtttaaaaaaagcaaaatgaagggg
aaagaaatgaacccgctgtttgccgaattgctcgagcagacaggcgagaagaaaatcaca
tggaatttcaataaatttctcgtcgaccggcacggccatgccattggctattacggctcg
cggacaaagccggaagaccttgaggaaaagatcgaggaactgctgcaggtatag

DBGET integrated database retrieval system