KEGG   Bacillus coagulans 36D1: Bcoa_1869Help
Entry
Bcoa_1869         CDS       T01628                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00010  Glycolysis / Gluconeogenesis
bag00620  Pyruvate metabolism
bag00640  Propanoate metabolism
bag00680  Methane metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01130  Biosynthesis of antibiotics
bag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcoa_1869
   00620 Pyruvate metabolism
    Bcoa_1869
   00640 Propanoate metabolism
    Bcoa_1869
  Energy metabolism
   00680 Methane metabolism
    Bcoa_1869
Enzymes [BR:bag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcoa_1869
Lipid biosynthesis proteins [BR:bag01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcoa_1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEP01056
UniProt: G2TK55
Position
2036425..2038380
Genome map
AA seq 651 aa AA seqDB search
MEQSGIAKSKLVYPSDDKIRSTEIGSSEAFEELLRLSQTDPEAFWGRVAKELTWYEPWKE
TMTGSLPGFRFFEGGVSNPCVNLLDRHVENGAGNRTALIWEGENGDSKFFTYNMLLAEVN
RFSNVLRGFGVKKGDCVAIFLPNLAEAVIAVLACFRIGAIYNTIFSGYSEKSLKDRLVNF
EPKVIVTADATERRGKKIFLKEKVDRVVPDIPSVKAVVVVDRLGTDVNMEAGRDYWWHEE
TRKASIHCEPERLEANEYGIVFYTSGTTGKPKGVVHSGMAFVVQNYIYAKYHMDHRDDDV
LWCSADIGWLTMHIWGIAGALSNGVTTVFYEGAIDYPEKDRFYRIIEKYRVNKLFTAPTA
LRMLKSMGEHPLEKYDLSCLDVVSLVGEPFDAETWQWTYEVLGRKKICVNNTWGQTETAG
SPLAGAAWLTPMKPGSAGRPFLGAVIDVVDQEGNPVPRGTLGNLVIQKPFPMLCRTLWKE
PERYLGSYFSQVDGCYYASDLAMIDEDGYVWVTGRSDDAFNVAGHRLSTMEMESAVLETP
GVSETAVIGVPDEIKGEVPVCFVRLSDGTEESEELKEAIKARIVDQIGKIAVPKAILFTD
TLPKTVSGKIMRRLLKEIVVNGAATGDMTGLEDPATIARIEQLVASHRAER
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaagcggcattgccaaaagcaaactcgtttatccaagtgatgataaaatccgt
tcaaccgaaatcggttcaagcgaagcatttgaggaactgctgcgcctgtcgcaaacggat
ccggaagcattttgggggcgcgttgccaaagagcttacctggtatgaaccgtggaaggaa
acaatgacaggcagcctccccgggttccgcttttttgaaggcggggtgagcaacccatgt
gtgaacctgcttgaccgccatgtcgaaaacggtgccggcaaccggacggcgctcatatgg
gaaggggaaaacggcgattcgaagttttttacgtacaatatgctgcttgcagaagtaaat
cggttcagcaatgtgttgcgcgggttcggcgtaaaaaaaggcgactgcgtggcgattttc
ctgccaaacttagcggaagcggtgattgctgtgctcgcatgcttccggattggcgcgatt
tacaatacgattttttccggatactcggaaaaatcactgaaagaccggcttgtgaatttt
gaaccgaaagtcatcgtgacggccgatgcaaccgagcgaagagggaaaaagattttcctc
aaggaaaaagtcgaccgtgttgttccggacattccgtctgtcaaagcggtcgtcgttgtg
gaccggctcgggacggatgtcaatatggaggcgggccgcgactattggtggcatgaagaa
acaaggaaggcaagcatccattgtgagccggagcggctggaagcgaacgagtatggcatt
gtgttttacacaagcggcacaaccgggaaaccaaaaggcgttgtccattccggcatggcg
tttgtcgtgcaaaattacatttacgccaagtaccatatggaccatcgcgatgacgatgtg
ctctggtgctcggcggatatcggctggcttacgatgcatatttggggcattgccggcgcg
ctttcaaacggtgtcacaaccgtcttttacgaaggggcgattgattatccggaaaaagac
cggttttaccggatcattgaaaagtaccgggtgaacaaattgtttacagctccgaccgca
ctgaggatgttgaaaagcatgggggagcatccgcttgaaaaatatgatttatcgtgcctg
gatgtcgtctcccttgtcggcgagccgtttgatgcggaaacatggcagtggacatatgaa
gtgctcgggagaaaaaagatttgcgtgaataacacatgggggcagacggaaacagccgga
tcgccgcttgccggtgccgcctggctgaccccgatgaaaccgggttctgcgggccggccg
tttttaggcgctgtaatcgatgtcgtcgatcaggaaggaaatccggtgccgcgggggacg
ctcggaaaccttgtcattcaaaagccgtttccgatgctgtgccgcacgctttggaaagag
ccggaacgttatctcggctcgtatttcagccaggtggacggctgctactatgcaagcgac
ctggcgatgattgatgaggacggctacgtatgggtcaccggccgttcggatgatgcgttc
aatgttgcagggcacaggctgagcacgatggaaatggaaagtgcggtgctcgaaaccccg
ggtgtatctgaaaccgctgtcattggcgtgccggatgaaatcaagggcgaggtgccggtc
tgctttgtgcgtttgagcgacgggacggaggaaagtgaagaactgaaagaagcgatcaag
gcccggattgtcgatcaaatcgggaaaattgccgtgccgaaagcgattttgtttacggac
acgttgcccaaaacagtgagcgggaaaatcatgcgccgcttgttaaaggaaattgtcgta
aacggtgcggctacaggggatatgaccggcctcgaggatcccgcaaccattgcgcgcatt
gaacagctggtggccagccacagggcggaaagataa

DBGET integrated database retrieval system