KEGG   Bacillus coagulans 36D1: Bcoa_2095Help
Entry
Bcoa_2095         CDS       T01628                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01130  Biosynthesis of antibiotics
bag01230  Biosynthesis of amino acids
Module
bag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcoa_2095
Enzymes [BR:bag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bcoa_2095
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Bcoa_2095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI FMN_dh QRPTase_C IMPDH AP_endonuc_2 Radical_SAM NanE His_biosynth Glyco_trans_1_2 Lactamase_B_5
Motif
Other DBs
NCBI-ProteinID: AEP01279
UniProt: G2TKC2
Position
2286966..2288390
Genome map
AA seq 474 aa AA seqDB search
MAFLEKILAEKEKEVARIKAAGKAFAPNARKAPSLYETFMHAEKTSIIAEIKRASPSKGD
IRTGVDPIRQALAYEKAGAGAISVLTDEIFFKGSVEDLKAVSDAVRLPVLCKDFIIDEIQ
IDRAKAYGASVILLIAAALSPERLRQLYDYARGAGLEVLLEVHNEAELETAVETGARIIG
INNRNLKTFDVDLGVAKKLAPKISNPDVLVISESGIRTRKDVVRAEHAGAKGILVGETLM
RANDPETAIKRLTGLPEKRKVKVCGIRTLEAARAAVSAGADMIGFVFAESKRKITPEKAV
QIAEALPDHVEKVGVFVNESPEKMAEIAERAGLDYLQLHGDETAEDVAQIPYPVIKAFPV
RTDADLEAIHDYRCDLVLLDSAGGKYRGGNGKAFDWELAKALSDERAVVLAGGLTPENVE
AAILSARPHIVDVSSGVETNGEKDPDKIKTFVQAARKVFQKLEERDDNANIQTA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcatttttagaaaagattttagccgaaaaagaaaaagaagtggcccgtatcaaagct
gcaggaaaggcttttgccccaaacgcgcgcaaagccccttctctttatgaaacatttatg
cacgccgaaaaaacaagcatcattgctgaaatcaaacgggcctccccatcaaaaggggat
atccgaacgggcgtggatcccatccggcaggcgcttgcctacgaaaaagcaggcgccggc
gccatttccgttttaacggacgaaatcttttttaaaggatcggtggaagatttgaaagcc
gtaagcgatgcagtccggcttccggttctctgtaaagattttatcatcgacgaaatccag
atcgaccgggcaaaagcatatggtgcaagcgtaattctcctgatcgcagcggctctttcc
cccgaaaggctccgtcagctgtacgattatgcccggggcgccggccttgaagtgctgctt
gaagtgcacaatgaagcggaactggaaaccgctgtggaaacaggggcccggattatcggc
atcaacaaccgcaatttaaagacgtttgacgttgatctcggcgttgccaaaaagctcgcg
ccaaaaatctcaaatccggatgtgcttgtgattagtgaaagcggcatccgcacccggaaa
gatgtcgttcgcgctgaacatgccggggcaaaagggattttagtcggggaaacgctgatg
cgtgcaaacgacccggaaacggcaataaaaagactgaccggtctcccggagaaacggaaa
gtcaaggtttgcggcattcgcacgcttgaagcggcccgagcggctgtctctgcaggggcg
gacatgatcggctttgtatttgccgaaagcaaacggaagattacaccggaaaaagcagta
cagattgcagaagcgttgccggatcatgtcgaaaaagtgggcgtattcgtcaatgaatcg
cctgaaaaaatggcggaaattgcagagcgggccgggctcgattacctgcagctgcacggt
gatgaaacagcagaagacgtcgcgcaaatcccttatccggtaatcaaggctttcccggta
aggacagatgctgatctcgaagcgatacacgattaccggtgcgatctggtgcttttggac
agcgccggcggaaaatatcgcggcggtaacggaaaggcgtttgactgggaattggcaaag
gcgctatcggatgagcgggcggtggtgcttgccggcgggctcacaccggaaaatgtcgaa
gccgcgattctttccgcccggccgcatatcgtcgacgtttcaagcggggtggagacaaac
ggggaaaaagacccggataaaatcaaaacctttgtgcaagcagcaagaaaagtatttcaa
aaattagaggagcgtgacgataatgcaaacatacaaactgcctga

DBGET integrated database retrieval system